DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps20 and Chmp7

DIOPT Version :9

Sequence 1:NP_611686.2 Gene:Vps20 / 37581 FlyBaseID:FBgn0034744 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_598839.2 Gene:Chmp7 / 105513 MGIID:1913922 Length:451 Species:Mus musculus


Alignment Length:195 Identity:48/195 - (24%)
Similarity:87/195 - (44%) Gaps:22/195 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KTAPSRITDQDKAVLQLKQQRDRLKQYQKRIETQLENDRLLARKCLQQGRKDRAKLLLRKKKYQE 75
            |.:|  :.|.|..|.||.|....|.:..:.:..:.|..:..||:..:.|:|..|...|:.|:..|
Mouse   230 KVSP--VNDVDVGVYQLMQSEQLLSRKVESLSQESERCKEEARRACRAGKKQLALRSLKAKQRTE 292

  Fly    76 SLLTNADKQLENLEKLAADIEFAQVEMKVLDGLKAGNAALKKVHEMLDIDEVERIMDETREGIEK 140
            ..:.....:|:.::.:...|..:|.:..|.:..:||..|||...:.:.:::.|.::|:.:|..:.
Mouse   293 KRIEALHAKLDTVQGILDRIYASQTDQMVFNAYQAGVGALKLSMKDVTVEKAESLVDQIQELCDT 357

  Fly   141 QQEIDAILTDVLTTQ---DEEDVLAELDALEAEEEQQKGAQLPDVPTEDLPIPAEIESVEEPAKT 202
            |.|:...|...:|..   |.|::..|||.|           |.|..||.|.:      :|.|.:|
Mouse   358 QDEVSQTLAGGVTNGLDFDSEELEKELDIL-----------LQDTTTEPLSL------LETPQET 405

  Fly   203  202
            Mouse   406  405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps20NP_611686.2 Snf7 22..186 CDD:281366 39/166 (23%)
Chmp7NP_598839.2 Snf7 243..390 CDD:304451 36/157 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.