DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vps20 and chmp6

DIOPT Version :9

Sequence 1:NP_611686.2 Gene:Vps20 / 37581 FlyBaseID:FBgn0034744 Length:212 Species:Drosophila melanogaster
Sequence 2:XP_012826961.1 Gene:chmp6 / 100125185 XenbaseID:XB-GENE-973527 Length:204 Species:Xenopus tropicalis


Alignment Length:189 Identity:98/189 - (51%)
Similarity:136/189 - (71%) Gaps:9/189 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VLQLKQQRDRLKQYQKRIETQLENDRLLARKCLQQGRKDRAKLLLRKKKYQESLLTNADKQLENL 88
            |.|||||||:|:||||:|..||:.:|.||::.|..|:|::|||||:||:|||.||...|.|:.||
 Frog    24 VQQLKQQRDKLRQYQKKITLQLQRERELAKQLLHDGKKEKAKLLLKKKRYQEQLLEKTDNQISNL 88

  Fly    89 EKLAADIEFAQVEMKVLDGLKAGNAALKKVHEMLDIDEVERIMDETREGIEKQQEIDAILTDVLT 153
            ||:..||||||:||||::|||.||..|||:||::.|:||||||:||::|||.|::||.:|:..||
 Frog    89 EKMVEDIEFAQIEMKVIEGLKVGNECLKKMHEVMSIEEVERIMEETQDGIEYQRQIDEMLSGSLT 153

  Fly   154 TQDEEDVLAELDALEAEEEQQKGAQLPDVPTEDLPIPAEIESVEEPAKTKATKKVLVEA 212
            .:|||.:|.||:|:..|:     .:||:.|:|.||    ..:.|:.|.....|..||.|
 Frog   154 AEDEEAILEELEAITQED-----LELPEAPSEPLP----DTTPEKQAVKNKPKPQLVAA 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vps20NP_611686.2 Snf7 22..186 CDD:281366 89/161 (55%)
chmp6XP_012826961.1 Snf7 24..>152 CDD:304451 76/127 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 185 1.000 Domainoid score I3333
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H11607
Inparanoid 1 1.050 188 1.000 Inparanoid score I3786
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1287094at2759
OrthoFinder 1 1.000 - - FOG0003546
OrthoInspector 1 1.000 - - oto102529
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5973
SonicParanoid 1 1.000 - - X4514
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.