DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS16 and rplD

DIOPT Version :10

Sequence 1:NP_611685.1 Gene:RpS16 / 37580 FlyBaseID:FBgn0034743 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_417778.1 Gene:rplD / 947818 ECOCYCID:EG10867 Length:201 Species:Escherichia coli


Alignment Length:73 Identity:18/73 - (24%)
Similarity:29/73 - (39%) Gaps:20/73 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 RVRVSGGGHV---------AQIYAIRQAISKA-LVAFYQKYVDEASK----------KEIKDILV 115
            |..|:|.|..         |:..:|:..|.:: .|.|..:..|.:.|          |.|...||
E. coli    49 RAEVTGSGKKPWRQKGTGRARSGSIKSPIWRSGGVTFAARPQDHSQKVNKKMYRGALKSILSELV 113

  Fly   116 QYDRTLLV 123
            :.||.::|
E. coli   114 RQDRLIVV 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS16NP_611685.1 PTZ00086 2..148 CDD:185437 18/73 (25%)
rplDNP_417778.1 RplD 1..201 CDD:439858 18/73 (25%)

Return to query results.
Submit another query.