DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS16 and YML6

DIOPT Version :9

Sequence 1:NP_001286731.1 Gene:RpS16 / 37580 FlyBaseID:FBgn0034743 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_013687.1 Gene:YML6 / 854983 SGDID:S000004487 Length:286 Species:Saccharomyces cerevisiae


Alignment Length:81 Identity:22/81 - (27%)
Similarity:31/81 - (38%) Gaps:20/81 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VNGRPLEQIEPKVLQYKLQEPLLLLGKEKFAGVDIRVRVSGGGHVAQIYAIRQAISKALVAFYQK 100
            |.|:  |..|.:|:..|..|...|.||......|               ..|:.:.|:...:.||
Yeast   195 VEGK--EIFEGEVIFRKFLEEFQLKGKRLLFITD---------------KTREGLIKSSDPYKQK 242

  Fly   101 YVDEASKK--EIKDIL 114
             ||...|:  |:.|||
Yeast   243 -VDVIQKELVEVNDIL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS16NP_001286731.1 PTZ00086 2..148 CDD:185437 22/81 (27%)
YML6NP_013687.1 Ribosomal_L4 58..272 CDD:395455 22/81 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0088
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.