DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS16 and RPS16B

DIOPT Version :9

Sequence 1:NP_001286731.1 Gene:RpS16 / 37580 FlyBaseID:FBgn0034743 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_010200.1 Gene:RPS16B / 851476 SGDID:S000002241 Length:143 Species:Saccharomyces cerevisiae


Alignment Length:140 Identity:91/140 - (65%)
Similarity:117/140 - (83%) Gaps:0/140 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VQAVQVFGRKKTATAVAYCKRGNGLLKVNGRPLEQIEPKVLQYKLQEPLLLLGKEKFAGVDIRVR 73
            |.:||.||:||:|||||:.|.|.||:||||.|:..:||::|::|:.|||||:|.:||:.:|||||
Yeast     4 VPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVEPEILRFKVYEPLLLVGLDKFSNIDIRVR 68

  Fly    74 VSGGGHVAQIYAIRQAISKALVAFYQKYVDEASKKEIKDILVQYDRTLLVGDPRRCEPKKFGGPG 138
            |:|||||:|:|||||||:|.|||::||||||.||.|:|.....||||||:.|.||.|||||||.|
Yeast    69 VTGGGHVSQVYAIRQAIAKGLVAYHQKYVDEQSKNELKKAFTSYDRTLLIADSRRPEPKKFGGKG 133

  Fly   139 ARARYQKSYR 148
            ||:|:|||||
Yeast   134 ARSRFQKSYR 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS16NP_001286731.1 PTZ00086 2..148 CDD:185437 89/138 (64%)
RPS16BNP_010200.1 PLN00210 3..143 CDD:177799 89/138 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344130
Domainoid 1 1.000 188 1.000 Domainoid score I651
eggNOG 1 0.900 - - E1_COG0088
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H794
Inparanoid 1 1.050 195 1.000 Inparanoid score I884
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62208
OrthoFinder 1 1.000 - - FOG0002170
OrthoInspector 1 1.000 - - otm46836
orthoMCL 1 0.900 - - OOG6_100841
Panther 1 1.100 - - LDO PTHR21569
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1233
SonicParanoid 1 1.000 - - X1447
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.