DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS16 and AT5G18380

DIOPT Version :9

Sequence 1:NP_001286731.1 Gene:RpS16 / 37580 FlyBaseID:FBgn0034743 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_197339.1 Gene:AT5G18380 / 831956 AraportID:AT5G18380 Length:146 Species:Arabidopsis thaliana


Alignment Length:139 Identity:101/139 - (72%)
Similarity:127/139 - (91%) Gaps:0/139 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QAVQVFGRKKTATAVAYCKRGNGLLKVNGRPLEQIEPKVLQYKLQEPLLLLGKEKFAGVDIRVRV 74
            ::||.|||||||.||.:||||:||:|:||.|:|..:|::|::|:.||:|||||.:||||::|:||
plant     8 ESVQCFGRKKTAVAVTHCKRGSGLIKLNGCPIELFQPEILRFKIFEPVLLLGKHRFAGVNMRIRV 72

  Fly    75 SGGGHVAQIYAIRQAISKALVAFYQKYVDEASKKEIKDILVQYDRTLLVGDPRRCEPKKFGGPGA 139
            :||||.:|:|||||:|:|||||:|||||||.||||||||||:|||||||.||||||||||||.||
plant    73 NGGGHTSQVYAIRQSIAKALVAYYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCEPKKFGGRGA 137

  Fly   140 RARYQKSYR 148
            |:|||||||
plant   138 RSRYQKSYR 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS16NP_001286731.1 PTZ00086 2..148 CDD:185437 99/137 (72%)
AT5G18380NP_197339.1 PLN00210 6..146 CDD:177799 99/137 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 214 1.000 Domainoid score I762
eggNOG 1 0.900 - - E1_COG0088
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H794
Inparanoid 1 1.050 220 1.000 Inparanoid score I1207
OMA 1 1.010 - - QHG62208
OrthoDB 1 1.010 - - D1347615at2759
OrthoFinder 1 1.000 - - FOG0002170
OrthoInspector 1 1.000 - - otm2899
orthoMCL 1 0.900 - - OOG6_100841
Panther 1 1.100 - - LDO PTHR21569
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1447
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.