DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS16 and Rpl4

DIOPT Version :9

Sequence 1:NP_001286731.1 Gene:RpS16 / 37580 FlyBaseID:FBgn0034743 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_077174.1 Gene:Rpl4 / 67891 MGIID:1915141 Length:419 Species:Mus musculus


Alignment Length:123 Identity:26/123 - (21%)
Similarity:49/123 - (39%) Gaps:32/123 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QVFGRKKTATAVAYCKR------------------GNGLLKVNGRPLEQIEPKVL---------Q 50
            :|.|.|||..||...|:                  |.|.:: |.|.:::..|.::         .
Mouse   157 KVEGYKKTKEAVQLLKKLKAWNDIKKVYASQRMRAGKGKMR-NRRRIQRRGPCIIYNEDNGIIKA 220

  Fly    51 YKLQEPLLLLGKEKFAGVDIRVRVSGGGHVAQIYAIRQAISKALVAFYQKYVDEASKK 108
            ::....:.||...|   ::| ::::.||||.:.....::..:.|...|..:...||.|
Mouse   221 FRNIPGITLLNVSK---LNI-LKLAPGGHVGRFCIWTESAFRKLDELYGTWRKAASLK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS16NP_001286731.1 PTZ00086 2..148 CDD:185437 26/123 (21%)
Rpl4NP_077174.1 PTZ00428 2..352 CDD:185611 26/123 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..419
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0088
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.