DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS16 and rps16

DIOPT Version :9

Sequence 1:NP_001286731.1 Gene:RpS16 / 37580 FlyBaseID:FBgn0034743 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001011146.1 Gene:rps16 / 496563 XenbaseID:XB-GENE-5786511 Length:146 Species:Xenopus tropicalis


Alignment Length:141 Identity:124/141 - (87%)
Similarity:134/141 - (95%) Gaps:0/141 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PVQAVQVFGRKKTATAVAYCKRGNGLLKVNGRPLEQIEPKVLQYKLQEPLLLLGKEKFAGVDIRV 72
            |:|:||||||||||||||:|||||||:||||||||.|||..|||||.||:||||||:||||||||
 Frog     6 PLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPATLQYKLLEPVLLLGKERFAGVDIRV 70

  Fly    73 RVSGGGHVAQIYAIRQAISKALVAFYQKYVDEASKKEIKDILVQYDRTLLVGDPRRCEPKKFGGP 137
            ||.|||||||:|||||||||:|||:|||||||||||||||||:||||||||.||||||.||||||
 Frog    71 RVKGGGHVAQVYAIRQAISKSLVAYYQKYVDEASKKEIKDILIQYDRTLLVADPRRCESKKFGGP 135

  Fly   138 GARARYQKSYR 148
            |||||||||||
 Frog   136 GARARYQKSYR 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS16NP_001286731.1 PTZ00086 2..148 CDD:185437 122/139 (88%)
rps16NP_001011146.1 PLN00210 6..146 CDD:177799 122/139 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 243 1.000 Domainoid score I2181
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H794
Inparanoid 1 1.050 256 1.000 Inparanoid score I3082
OMA 1 1.010 - - QHG62208
OrthoDB 1 1.010 - - D1347615at2759
OrthoFinder 1 1.000 - - FOG0002170
OrthoInspector 1 1.000 - - oto104121
Panther 1 1.100 - - LDO PTHR21569
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1233
SonicParanoid 1 1.000 - - X1447
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.