DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS16 and mRpS9

DIOPT Version :9

Sequence 1:NP_001286731.1 Gene:RpS16 / 37580 FlyBaseID:FBgn0034743 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_524270.2 Gene:mRpS9 / 40932 FlyBaseID:FBgn0037529 Length:395 Species:Drosophila melanogaster


Alignment Length:156 Identity:51/156 - (32%)
Similarity:70/156 - (44%) Gaps:29/156 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QQKRRE-PVQAVQVFGR---------KKTATA-VAYCKRGNGLLKVNGRPLEQIEPKVLQYKLQE 55
            |.|:.| |...:...||         :|||.| |.....|.|.:.:||:.:...|.:..:.:|..
  Fly   250 QSKQLEVPKPRIDEEGRQYITTYECLRKTARADVTVRLPGTGKISINGKDISYFEDENCREQLLF 314

  Fly    56 PLL---LLGKEKFAGVDIRVRVSGGGHVAQIYAIRQAISKALVAFYQKYVDEASKKEIKDILVQY 117
            ||.   ||||     ||:...|.|||...|..|||..|:.:|.:|..:.:.|:.:.         
  Fly   315 PLQFSELLGK-----VDVEANVEGGGPSGQAGAIRWGIAMSLRSFVDQEMIESMRL--------- 365

  Fly   118 DRTLLVGDPRRCEPKKFGGPGARARY 143
             ..||..|.||.|.||||..|||.:|
  Fly   366 -AGLLTRDYRRRERKKFGQEGARRKY 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS16NP_001286731.1 PTZ00086 2..148 CDD:185437 51/156 (33%)
mRpS9NP_524270.2 Ribosomal_S9 276..395 CDD:278792 45/130 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466357
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21569
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.