DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS16 and RGD1561137

DIOPT Version :9

Sequence 1:NP_001286731.1 Gene:RpS16 / 37580 FlyBaseID:FBgn0034743 Length:148 Species:Drosophila melanogaster
Sequence 2:XP_038961985.1 Gene:RGD1561137 / 366030 RGDID:1561137 Length:157 Species:Rattus norvegicus


Alignment Length:141 Identity:118/141 - (83%)
Similarity:130/141 - (92%) Gaps:0/141 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PVQAVQVFGRKKTATAVAYCKRGNGLLKVNGRPLEQIEPKVLQYKLQEPLLLLGKEKFAGVDIRV 72
            |:|:|||||.||||||||:|||||||:||||||||.||.:.|||||.||:||||||:.|||||:|
  Rat     6 PLQSVQVFGCKKTATAVAHCKRGNGLIKVNGRPLEMIESRTLQYKLLEPVLLLGKERLAGVDIQV 70

  Fly    73 RVSGGGHVAQIYAIRQAISKALVAFYQKYVDEASKKEIKDILVQYDRTLLVGDPRRCEPKKFGGP 137
            ||.||||||||||.||:|||||||:|||||||||||||||||:|||:||||.||.|||.||||||
  Rat    71 RVKGGGHVAQIYATRQSISKALVAYYQKYVDEASKKEIKDILIQYDQTLLVADPCRCESKKFGGP 135

  Fly   138 GARARYQKSYR 148
            |||||||||||
  Rat   136 GARARYQKSYR 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS16NP_001286731.1 PTZ00086 2..148 CDD:185437 116/139 (83%)
RGD1561137XP_038961985.1 PLN00210 6..146 CDD:177799 116/139 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341875
Domainoid 1 1.000 245 1.000 Domainoid score I2115
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 257 1.000 Inparanoid score I3070
OMA 1 1.010 - - QHG62208
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002170
OrthoInspector 1 1.000 - - otm45643
orthoMCL 1 0.900 - - OOG6_100841
Panther 1 1.100 - - O PTHR21569
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1447
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.