DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS16 and rps1602

DIOPT Version :9

Sequence 1:NP_001286731.1 Gene:RpS16 / 37580 FlyBaseID:FBgn0034743 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_593452.1 Gene:rps1602 / 2543559 PomBaseID:SPAC664.04c Length:140 Species:Schizosaccharomyces pombe


Alignment Length:140 Identity:99/140 - (70%)
Similarity:119/140 - (85%) Gaps:0/140 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VQAVQVFGRKKTATAVAYCKRGNGLLKVNGRPLEQIEPKVLQYKLQEPLLLLGKEKFAGVDIRVR 73
            :|:||.||:|..|||||:||.|.||:||||.||..::|::|:.|:.||:|:.|.:||||||||||
pombe     1 MQSVQCFGKKGNATAVAHCKVGKGLIKVNGAPLSLVQPEILRMKVYEPILVAGADKFAGVDIRVR 65

  Fly    74 VSGGGHVAQIYAIRQAISKALVAFYQKYVDEASKKEIKDILVQYDRTLLVGDPRRCEPKKFGGPG 138
            |||||||:||||||||||||:||:|||:|||.||.|:|..|:.|||||||.||||.|||||||.|
pombe    66 VSGGGHVSQIYAIRQAISKAIVAYYQKFVDEHSKAELKKALITYDRTLLVADPRRMEPKKFGGHG 130

  Fly   139 ARARYQKSYR 148
            ||||.|||||
pombe   131 ARARQQKSYR 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS16NP_001286731.1 PTZ00086 2..148 CDD:185437 97/138 (70%)
rps1602NP_593452.1 PLN00210 2..140 CDD:177799 97/137 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 197 1.000 Domainoid score I679
eggNOG 1 0.900 - - E1_COG0088
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H794
Inparanoid 1 1.050 205 1.000 Inparanoid score I974
OMA 1 1.010 - - QHG62208
OrthoFinder 1 1.000 - - FOG0002170
OrthoInspector 1 1.000 - - otm47291
orthoMCL 1 0.900 - - OOG6_100841
Panther 1 1.100 - - LDO PTHR21569
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1447
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.