DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS16 and Rps16

DIOPT Version :9

Sequence 1:NP_001286731.1 Gene:RpS16 / 37580 FlyBaseID:FBgn0034743 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_038675.2 Gene:Rps16 / 20055 MGIID:98118 Length:146 Species:Mus musculus


Alignment Length:141 Identity:125/141 - (88%)
Similarity:135/141 - (95%) Gaps:0/141 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PVQAVQVFGRKKTATAVAYCKRGNGLLKVNGRPLEQIEPKVLQYKLQEPLLLLGKEKFAGVDIRV 72
            |:|:||||||||||||||:|||||||:||||||||.|||:.|||||.||:||||||:||||||||
Mouse     6 PLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAGVDIRV 70

  Fly    73 RVSGGGHVAQIYAIRQAISKALVAFYQKYVDEASKKEIKDILVQYDRTLLVGDPRRCEPKKFGGP 137
            ||.|||||||||||||:|||||||:|||||||||||||||||:||||||||.||||||.||||||
Mouse    71 RVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVADPRRCESKKFGGP 135

  Fly   138 GARARYQKSYR 148
            |||||||||||
Mouse   136 GARARYQKSYR 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS16NP_001286731.1 PTZ00086 2..148 CDD:185437 123/139 (88%)
Rps16NP_038675.2 PLN00210 6..146 CDD:177799 123/139 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838095
Domainoid 1 1.000 245 1.000 Domainoid score I2186
eggNOG 1 0.900 - - E1_COG0088
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H794
Inparanoid 1 1.050 257 1.000 Inparanoid score I3145
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62208
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002170
OrthoInspector 1 1.000 - - oto93900
orthoMCL 1 0.900 - - OOG6_100841
Panther 1 1.100 - - LDO PTHR21569
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1233
SonicParanoid 1 1.000 - - X1447
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.