DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS16 and rps-16

DIOPT Version :9

Sequence 1:NP_001286731.1 Gene:RpS16 / 37580 FlyBaseID:FBgn0034743 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001379167.1 Gene:rps-16 / 179998 WormBaseID:WBGene00004485 Length:144 Species:Caenorhabditis elegans


Alignment Length:140 Identity:106/140 - (75%)
Similarity:126/140 - (90%) Gaps:0/140 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VQAVQVFGRKKTATAVAYCKRGNGLLKVNGRPLEQIEPKVLQYKLQEPLLLLGKEKFAGVDIRVR 73
            ||:||.|||||||||||:||:|.||:||||||||.:||::|:.||||||||:|||:|..||||:|
 Worm     5 VQSVQTFGRKKTATAVAHCKKGQGLIKVNGRPLEFLEPQILRIKLQEPLLLVGKERFQDVDIRIR 69

  Fly    74 VSGGGHVAQIYAIRQAISKALVAFYQKYVDEASKKEIKDILVQYDRTLLVGDPRRCEPKKFGGPG 138
            ||||||||||||:|||::|||||:|.|||||.||:|:|:|...||::|||.||||.|.|||||||
 Worm    70 VSGGGHVAQIYAVRQALAKALVAYYHKYVDEQSKRELKNIFAAYDKSLLVADPRRRESKKFGGPG 134

  Fly   139 ARARYQKSYR 148
            ||||||||||
 Worm   135 ARARYQKSYR 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS16NP_001286731.1 PTZ00086 2..148 CDD:185437 104/138 (75%)
rps-16NP_001379167.1 PTZ00086 1..144 CDD:185437 104/138 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159947
Domainoid 1 1.000 213 1.000 Domainoid score I1600
eggNOG 1 0.900 - - E1_COG0088
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H794
Inparanoid 1 1.050 223 1.000 Inparanoid score I2257
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62208
OrthoDB 1 1.010 - - D1347615at2759
OrthoFinder 1 1.000 - - FOG0002170
OrthoInspector 1 1.000 - - oto17888
orthoMCL 1 0.900 - - OOG6_100841
Panther 1 1.100 - - LDO PTHR21569
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1233
SonicParanoid 1 1.000 - - X1447
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.