DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS16 and Rps16

DIOPT Version :9

Sequence 1:NP_001286731.1 Gene:RpS16 / 37580 FlyBaseID:FBgn0034743 Length:148 Species:Drosophila melanogaster
Sequence 2:XP_006228674.1 Gene:Rps16 / 140655 RGDID:621031 Length:150 Species:Rattus norvegicus


Alignment Length:96 Identity:69/96 - (71%)
Similarity:80/96 - (83%) Gaps:8/96 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PVQAVQVFGRKKTATAVAYCKRGNGLLKVNGRPLEQIEPKVLQYKLQEPLLLLGKEKFAGVDIRV 72
            |:|:||||||||||||||:|||||||:||||||||.|||:.|||||.||:||||||:||||||||
  Rat     6 PLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGKERFAGVDIRV 70

  Fly    73 RVSGGGHVAQIY--------AIRQAISKALV 95
            ||.|||||||||        ::||.:.:..|
  Rat    71 RVKGGGHVAQIYGECEDLGVSVRQLLKQGWV 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS16NP_001286731.1 PTZ00086 2..148 CDD:185437 69/96 (72%)
Rps16XP_006228674.1 Ribosomal_S9 6..>102 CDD:294239 69/96 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341876
Domainoid 1 1.000 245 1.000 Domainoid score I2115
eggNOG 1 0.900 - - E1_COG0088
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H794
Inparanoid 1 1.050 257 1.000 Inparanoid score I3070
OMA 1 1.010 - - QHG62208
OrthoDB 1 1.010 - - D1347615at2759
OrthoFinder 1 1.000 - - FOG0002170
OrthoInspector 1 1.000 - - otm45643
orthoMCL 1 0.900 - - OOG6_100841
Panther 1 1.100 - - LDO PTHR21569
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1447
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.