DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS16 and LOC102548369

DIOPT Version :9

Sequence 1:NP_001286731.1 Gene:RpS16 / 37580 FlyBaseID:FBgn0034743 Length:148 Species:Drosophila melanogaster
Sequence 2:XP_038950006.1 Gene:LOC102548369 / 102548369 RGDID:7517571 Length:146 Species:Rattus norvegicus


Alignment Length:141 Identity:114/141 - (80%)
Similarity:125/141 - (88%) Gaps:0/141 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PVQAVQVFGRKKTATAVAYCKRGNGLLKVNGRPLEQIEPKVLQYKLQEPLLLLGKEKFAGVDIRV 72
            |:|:|||||.||||||||:||.||||:|||||.||.||...|||||.||:|.||||:||||||:|
  Rat     6 PLQSVQVFGCKKTATAVAHCKGGNGLIKVNGRSLEMIELCTLQYKLLEPVLHLGKERFAGVDIQV 70

  Fly    73 RVSGGGHVAQIYAIRQAISKALVAFYQKYVDEASKKEIKDILVQYDRTLLVGDPRRCEPKKFGGP 137
            ||.|||||||||||||:|||||||:|||||||||||||||||:||:.||.|.||||||.||||.|
  Rat    71 RVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYNPTLPVADPRRCESKKFGSP 135

  Fly   138 GARARYQKSYR 148
            ||||.||||||
  Rat   136 GARALYQKSYR 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS16NP_001286731.1 PTZ00086 2..148 CDD:185437 112/139 (81%)
LOC102548369XP_038950006.1 PLN00210 6..146 CDD:177799 112/139 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341877
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 257 1.000 Inparanoid score I3070
OMA 1 1.010 - - QHG62208
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002170
OrthoInspector 1 1.000 - - otm45643
orthoMCL 1 0.900 - - OOG6_100841
Panther 1 1.100 - - O PTHR21569
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1447
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.