DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nsr and QKI

DIOPT Version :9

Sequence 1:NP_001286736.1 Gene:nsr / 37577 FlyBaseID:FBgn0034740 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_006766.1 Gene:QKI / 9444 HGNCID:21100 Length:341 Species:Homo sapiens


Alignment Length:353 Identity:87/353 - (24%)
Similarity:149/353 - (42%) Gaps:92/353 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EEQNQDQPTQDQPTYQPRLNEVAQKFLADLDEERKRLSAEFPLCAL------LIDESVDRVFSTG 67
            |.:.:.:||.|              :|..|..::|.:|:....|.:      |:||.:.||    
Human     6 ETKEKPKPTPD--------------YLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRV---- 52

  Fly    68 RIPGKEFYADVYH--------QRP------MKITQKVFVPVNKFPKFNFARKILGPKGNSVRRLK 118
               .|:.|.|..:        :.|      :::.:|::|||.::|.|||..:||||:|.:.::|:
Human    53 ---RKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLE 114

  Fly   119 EETNCKIVIKGRSSMRDRNKEEELRSSGDPRYAHLHKDLFLEVSAVAPPAECYARIAYALAEIRK 183
            .||.|||:::|:.||||:.|||:.|  |.|.:.||::||.:.::..........::..|:.|::|
Human   115 AETGCKIMVRGKGSMRDKKKEEQNR--GKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKK 177

  Fly   184 YLIP--DDNDDVWHEQQRELMEMN---PESAKKSNGLNMA-------------------PYRSIF 224
            .|:|  :..|.:...|..||..:|   .::..||..|..:                   |..::.
Human   178 LLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALR 242

  Fly   225 DKTIGGNR--------------NGAPKYNNQIRRVTENPREVADMEEVEYDYDEHRMPPSRPSLG 275
            ..|..|..              ||.|.....|  |...|.  |.:....|:| .:.:.|:...| 
Human   243 TPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAI--VPPGPE--AGLIYTPYEY-PYTLAPATSIL- 301

  Fly   276 FEYSKPPPSMTATNATPFK----RAYPY 299
             ||...|..:....||..:    |.:||
Human   302 -EYPIEPSGVLGAVATKVRRHDMRVHPY 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nsrNP_001286736.1 SF1_like-KH 87..206 CDD:239088 44/123 (36%)
QKINP_006766.1 STAR_dimer 10..66 CDD:406848 16/76 (21%)
Qua1 domain, involved in homodimerization. /evidence=ECO:0000250|UniProtKB:Q17339 11..82 17/91 (19%)
KH-I_Hqk 81..183 CDD:411893 39/103 (38%)
Qua2 domain, involved in RNA binding. /evidence=ECO:0000269|PubMed:23630077 182..213 7/30 (23%)
PHA03247 <211..314 CDD:223021 19/109 (17%)
SH3-binding 276..279 0/2 (0%)
Quaking_NLS 312..341 CDD:406855 5/17 (29%)
Nuclear localization signal. /evidence=ECO:0000250 324..330 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155041
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.