DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nsr and AT4G26480

DIOPT Version :9

Sequence 1:NP_001286736.1 Gene:nsr / 37577 FlyBaseID:FBgn0034740 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001320071.1 Gene:AT4G26480 / 828754 AraportID:AT4G26480 Length:308 Species:Arabidopsis thaliana


Alignment Length:251 Identity:67/251 - (26%)
Similarity:119/251 - (47%) Gaps:53/251 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QPRLNEVAQKFLADLDEERKRLSAEFP----LCALLIDE------------SVDR---------- 62
            ||......:|:|::|..||.:|:...|    :|.|:..|            |..|          
plant    51 QPSFLVEQEKYLSELLAERHKLTPFLPVLPHVCRLMNQEILRVTTLLENALSQSRFDHPSPLASG 115

  Fly    63 -VFSTGRIPGKEFYADVYHQRP--------------------MKITQKVFVPVNKFPKFNFARKI 106
             :|...|.....:.:....:|.                    :|.|.:|.:||:|:|.:||..::
plant   116 GIFQNSRADMNGWASQFPSERSVSSSPAPNWLNSPGSSSGLIVKRTIRVDIPVDKYPNYNFVGRL 180

  Fly   107 LGPKGNSVRRLKEETNCKIVIKGRSSMRDRNKEEELRSSGDPRYAHLHKDLFLEVSAVAPPAECY 171
            |||:|||::|::..|:|:::|:||.|::|..||:.:|  |.|.|.||::.|.:.|.|..|.....
plant   181 LGPRGNSLKRVEASTDCRVLIRGRGSIKDPIKEDMMR--GKPGYEHLNEPLHILVEAELPIEIVD 243

  Fly   172 ARIAYALAEIRKYLIP-DDNDDVWHEQQ-RELMEMNPESAKKSNGL--NMAPYRSI 223
            ||:..|...:...|.| ::..|.:.:|| |||..:|....::.:.:  :::||.|:
plant   244 ARLMQAREILDDLLTPVEETHDFYKKQQLRELALLNGSLREEGSPMSGSISPYNSL 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nsrNP_001286736.1 SF1_like-KH 87..206 CDD:239088 45/120 (38%)
AT4G26480NP_001320071.1 STAR_dimer 61..>93 CDD:406848 9/31 (29%)
KH-I 159..259 CDD:412160 39/101 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.