DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nsr and AT3G08620

DIOPT Version :9

Sequence 1:NP_001286736.1 Gene:nsr / 37577 FlyBaseID:FBgn0034740 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_187474.2 Gene:AT3G08620 / 820009 AraportID:AT3G08620 Length:283 Species:Arabidopsis thaliana


Alignment Length:260 Identity:61/260 - (23%)
Similarity:119/260 - (45%) Gaps:62/260 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PTYQPRLNEVAQKFLADLDEERKRLS---AEFPLCALLIDESVDRVFSTGRIPGKEF--YADVYH 80
            |..:...::|..::::.|..|.::|.   ...|:|:.|:::.:.|:  ||.:|.:.|  :..:.|
plant    18 PQIRTPSSDVDSQYISQLLAEHQKLGPFMQVLPICSRLLNQEIFRI--TGMMPNQGFTDFDRLRH 80

  Fly    81 QR-------------------------------------------------PMKITQKVFVPVNK 96
            :.                                                 |:|...::.:||:.
plant    81 RSPSPMASPNLMSNVSGGGLGGWNGLPPERIGGPHGMAMEWQGAPASPSSYPVKRILRLDLPVDT 145

  Fly    97 FPKFNFARKILGPKGNSVRRLKEETNCKIVIKGRSSMRDRNKEEELRSSGDPRYAHLHKDLFLEV 161
            :|.|||..::|||:|||::|::..|.|::.|:|:.|::|..|||:|:  |.|.|.||::.|.:.:
plant   146 YPNFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPEKEEKLK--GKPGYEHLNEQLHILI 208

  Fly   162 SAVAPPAECYARIAYALAEIRKYLIPDD--NDDVWHEQQRELMEMNPESAKKSNGL--NMAPYRS 222
            .|..|......::..|...|.:.:.|.|  .|.:..:|.|||..:|....:.|.|.  :::|:.|
plant   209 EADLPIDIVDIKLRQAQEIIEELVKPVDESQDYIKRQQLRELALLNSNLRENSPGPSGSVSPFNS 273

  Fly   223  222
            plant   274  273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nsrNP_001286736.1 SF1_like-KH 87..206 CDD:239088 40/120 (33%)
AT3G08620NP_187474.2 STAR_dimer 28..74 CDD:406848 11/47 (23%)
KH-I 134..234 CDD:412160 34/101 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I2246
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.