DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nsr and AT2G38610

DIOPT Version :9

Sequence 1:NP_001286736.1 Gene:nsr / 37577 FlyBaseID:FBgn0034740 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_181395.1 Gene:AT2G38610 / 818443 AraportID:AT2G38610 Length:286 Species:Arabidopsis thaliana


Alignment Length:253 Identity:63/253 - (24%)
Similarity:117/253 - (46%) Gaps:65/253 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 AQKFLADLDEERKRLS---AEFPLCALLIDESVDRVFSTGRIPGKEF--YADVYHQRP------- 83
            :.::|.:|..|.::|:   ...|:|:.|:::.:.||  :|.:..:.|  :..:.|:.|       
plant    29 SSQYLTELLAEHQKLTPFMQVLPICSRLLNQEMFRV--SGMMSNQGFGDFDRLRHRSPSPMASSN 91

  Fly    84 ------------------------------------------MKITQKVFVPVNKFPKFNFARKI 106
                                                      :|...::.:||:.:|.|||..::
plant    92 LMSNVSNTGLGGWNGLSQERLSGTPGMTMDWQGAPGSPSSYTVKRILRLEIPVDNYPNFNFVGRL 156

  Fly   107 LGPKGNSVRRLKEETNCKIVIKGRSSMRDRNKEEELRSSGDPRYAHLHKDLFLEVSAVAPPAECY 171
            |||:|||::|::..|.|::.|:|:.|::|..||::||  |.|.|.||::.|.:.:.|..|.:...
plant   157 LGPRGNSLKRVEATTGCRVFIRGKGSIKDPEKEDKLR--GRPGYEHLNEQLHILIEADLPASIVE 219

  Fly   172 ARIAYALAEIRKYLIPDD--NDDVWHEQQRELMEMN-----PESAKKSNGLNMAPYRS 222
            .|:..|...|.:.|.|.|  .|.:..:|.|||..:|     .||...|.|.:::|:.|
plant   220 IRLRQAQEIIEELLKPVDESQDFIKRQQLRELALLNSNNLREESPGPSGGGSVSPFNS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nsrNP_001286736.1 SF1_like-KH 87..206 CDD:239088 43/125 (34%)
AT2G38610NP_181395.1 STAR_dimer 29..75 CDD:406848 11/47 (23%)
KH-I 135..235 CDD:412160 36/101 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I2246
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.