DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nsr and SF1

DIOPT Version :9

Sequence 1:NP_001286736.1 Gene:nsr / 37577 FlyBaseID:FBgn0034740 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001365886.1 Gene:SF1 / 7536 HGNCID:12950 Length:764 Species:Homo sapiens


Alignment Length:342 Identity:79/342 - (23%)
Similarity:144/342 - (42%) Gaps:74/342 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QDQPTQDQPTYQ---PRLNEVAQKFLADLDEERKRLSAEFPLCALLIDESVDRVFSTGRIPGKEF 74
            :|:....:|.|.   .|||....:....|:|||..|..|  :.||                ..:|
Human   202 EDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITE--MVAL----------------NPDF 248

  Fly    75 YADVYHQRP-MKITQKVFVPVNKFPKFNFARKILGPKGNSVRRLKEETNCKIVIKGRSSMRD--- 135
            .....::.| .:::.||.:|.:::|:.||...::||:||:::.:::|.|.||:|:|:.|:::   
Human   249 KPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKV 313

  Fly   136 -RNKEEELRSSGDPRYAHLHKDLFLEVSAVAPPAECYARIAYALAEIRKYL-----IPDDNDDVW 194
             |...:.|....:|.:|.:             .|.....:..|:.:||..|     .|:|.:|:.
Human   314 GRKDGQMLPGEDEPLHALV-------------TANTMENVKKAVEQIRNILKQGIETPEDQNDLR 365

  Fly   195 HEQQRELMEMNPESAKKSNGLNMAPY-----RSIFDKTIGGNRNGAPKYNNQIR-RVTENPREVA 253
            ..|.|||..:|....:..|.: :.|:     |||.:.|:.....||....:..: :...:|:...
Human   366 KMQLRELARLNGTLREDDNRI-LRPWQSSETRSITNTTVCTKCGGAGHIASDCKFQRPGDPQSAQ 429

  Fly   254 DMEEVEYDY-------DEHRMP-----PSRPSLGFEYSKPPPSMTATNATPFKRAYPYPTDMNRT 306
            |...::.:|       .|..:|     .|.|:.....|.|.|:..|.|..|       |:.|:.|
Human   430 DKARMDKEYLSLMAELGEAPVPASVGSTSGPATTPLASAPRPAAPANNPPP-------PSLMSTT 487

  Fly   307 R-EPPIKSYKPN---PY 319
            : .||..:..|:   ||
Human   488 QSRPPWMNSGPSESRPY 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nsrNP_001286736.1 SF1_like-KH 87..206 CDD:239088 33/127 (26%)
SF1NP_001365886.1 MSL5 142..382 CDD:227503 50/210 (24%)
ZnF_C2HC 403..418 CDD:197667 2/14 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.731683 Normalized mean entropy S1317
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.