DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nsr and sf1

DIOPT Version :9

Sequence 1:NP_001286736.1 Gene:nsr / 37577 FlyBaseID:FBgn0034740 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_009301350.1 Gene:sf1 / 572785 ZFINID:ZDB-GENE-030131-2492 Length:663 Species:Danio rerio


Alignment Length:368 Identity:83/368 - (22%)
Similarity:144/368 - (39%) Gaps:103/368 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QDQPTQDQPTYQ---PRLNEVAQKFLADLDEERKRLSAEFPLCALLIDESVDRVFSTGRIPGKEF 74
            :|:....:|.|.   .|||....:....|:|||..|..|.                .|..|  ||
Zfish   149 EDRSPSPEPIYNSEGKRLNTREYRTRKKLEEERHSLITEM----------------VGLNP--EF 195

  Fly    75 YADVYHQRP-MKITQKVFVPVNKFPKFNFARKILGPKGNSVRRLKEETNCKIVIKGRSSMRD--- 135
            .....::.| .:::.||.:|.:::|:.||...::||:||:::.:::|...||:|:|:.|:::   
Zfish   196 KPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECCAKIMIRGKGSVKEGKV 260

  Fly   136 -RNKEEELRSSGDPRYAHLHKDLFLEVSAVAPPAECYARIAYALAEIRKYL-----IPDDNDDVW 194
             |...:.|....:|.:|.:             .|.....:..|:.:||..|     .|:|.:|:.
Zfish   261 GRKDGQMLPGEDEPLHALV-------------TANTMENVKKAVEQIRNILKQGIETPEDQNDLR 312

  Fly   195 HEQQRELMEMNPESAKKSNGLNMAPY-----RSIFDKTIGGNRNGAPKYNNQIR-------RVTE 247
            ..|.|||..:|....:..|.: :.|:     |||.:.|:.....||...::..:       |..|
Zfish   313 KMQLRELARLNGTLREDDNRI-LRPWQSTEPRSITNTTLCTKCGGAGHISSDCKFTSSFAPRPGE 376

  Fly   248 NPREVADMEEVEYDY-----------------DEHRMPPS--RPSLGFEYSKPPPSMTATNATPF 293
            .|:...|...::.:|                 ..:..|||  ||| |...::|||     |..|:
Zfish   377 PPQSAQDKARMDKEYLSLMAELGEAPVPSSGGGHNNAPPSGPRPS-GPNNNQPPP-----NRPPW 435

  Fly   294 KRAYP------------------YPTDMNRTREPPIKSYKPNP 318
            ..:.|                  :|..|.....||:   .|||
Zfish   436 MNSGPTDNRNFHGMHQGPGGPHNFPPPMPNMGGPPM---PPNP 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nsrNP_001286736.1 SF1_like-KH 87..206 CDD:239088 32/127 (25%)
sf1XP_009301350.1 SF1-HH 90..202 CDD:292892 16/70 (23%)
SF1_like-KH 209..327 CDD:239088 33/130 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.