DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nsr and SF1

DIOPT Version :9

Sequence 1:NP_001286736.1 Gene:nsr / 37577 FlyBaseID:FBgn0034740 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_524654.2 Gene:SF1 / 43912 FlyBaseID:FBgn0025571 Length:787 Species:Drosophila melanogaster


Alignment Length:347 Identity:74/347 - (21%)
Similarity:141/347 - (40%) Gaps:92/347 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PTQDQPTYQP-------RLNEVAQKFLADLDEERKRLSAEFPLCALLIDESVDRVFSTGRIPGKE 73
            |.:..|:.:|       |||....::...|:|:|.:|..:.        ::|:          .|
  Fly   331 PEERSPSPEPIYSSDGKRLNTREFRYRKRLEEQRHQLIVKM--------QTVN----------PE 377

  Fly    74 FYADVYHQRPM-KITQKVFVPVNKFPKFNFARKILGPKGNSVRRLKEETNCKIVIKGRSSMRD-- 135
            |.....::.|: :::.||.:|..:.|..||...::||:||:::.::::|..||:|:|:.|:::  
  Fly   378 FKPPADYKPPVTRVSDKVLIPQEQHPDINFVGLLIGPRGNTLKAMEKDTGAKIIIRGKGSVKEGK 442

  Fly   136 --RNKEEELRSSGDPRYAHLHKDLFLEVSAVAPPAECYARIAYALAE-IRKYL-IPDDNDDVWHE 196
              |...:.|....:|.:|.:          .||..|...:....:.: ||:.: :|:.::|:...
  Fly   443 VGRKDGQPLPGEDEPLHAFI----------TAPNPEAVRKAVDKIKDVIRQGIEVPEGHNDLRRM 497

  Fly   197 QQRELMEMNPESAKKSNGLN------------MAPYRSIFDKTI-----GGNRNGAPKYNNQIRR 244
            |.|||.::|  ...:.|.:.            ..|.:.|...||     ||        ...:.:
  Fly   498 QLRELAQLN--GTLRENDIQRCTCGSTDHKSWQCPDKPIITNTIVCTSCGG--------TGHLTK 552

  Fly   245 VTENPREVADM-----EEVEYDYDEHRMPPSRPSLGFEYSK--PPPSMTATNATP-------FKR 295
            ...|.|..:.:     |:.:...||..|     ||..|..:  ||||.:|....|       .:.
  Fly   553 DCRNKRPGSGVPGMACEDSQAKIDEEYM-----SLMAELGEGPPPPSASAKTDPPASNGPQLHRA 612

  Fly   296 AYPY----PTDMNRTREPPIKS 313
            :|..    |:.|...:.||..|
  Fly   613 SYSIFDKKPSQMQAIQSPPSSS 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nsrNP_001286736.1 SF1_like-KH 87..206 CDD:239088 31/124 (25%)
SF1NP_524654.2 MSL5 253..512 CDD:227503 46/210 (22%)
SF1-HH 274..385 CDD:292892 13/71 (18%)
SF1_like-KH 392..510 CDD:239088 32/129 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460732
Domainoid 1 1.000 45 1.000 Domainoid score I3083
eggNOG 1 0.900 - - E1_COG5176
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.