DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nsr and how

DIOPT Version :9

Sequence 1:NP_001286736.1 Gene:nsr / 37577 FlyBaseID:FBgn0034740 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001262822.1 Gene:how / 42596 FlyBaseID:FBgn0264491 Length:418 Species:Drosophila melanogaster


Alignment Length:224 Identity:66/224 - (29%)
Similarity:118/224 - (52%) Gaps:32/224 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ETQSEFTEEQNQDQ------PTQDQPTYQPRLNEVAQKFLADLDEERKRLSA---EFPLCALLID 57
            :.|::..::|...|      |....|..|.:..:....:||.|.::||:|:|   .|.....|:|
  Fly    40 QAQAQAQQQQQAPQVVVPMTPQHLTPQQQQQSTQSIADYLAQLLKDRKQLAAFPNVFTHVERLLD 104

  Fly    58 ESVDRVFSTGRIPGKEFYADVYHQRPMKI----------TQKVFVPVNKFPKFNFARKILGPKGN 112
            |.:      .|:....|..:...:.|:.:          .:||:|||.:.|.|||..:||||:|.
  Fly   105 EEI------ARVRASLFQINGVKKEPLTLPEPEGSVVTMNEKVYVPVREHPDFNFVGRILGPRGM 163

  Fly   113 SVRRLKEETNCKIVIKGRSSMRDRNKEEELRSSGDPRYAHLHKDLFLEVSAVAPPAECYARIAYA 177
            :.::|::||.|||:::|:.||||:.||:..|  |.|.:.||..||.:.::..........::|.|
  Fly   164 TAKQLEQETGCKIMVRGKGSMRDKKKEDANR--GKPNWEHLSDDLHVLITVEDTENRATVKLAQA 226

  Fly   178 LAEIRKYLIP--DDNDDVWHEQQRELMEM 204
            :||::|.|:|  :..|::   ::|:|||:
  Fly   227 VAEVQKLLVPQAEGEDEL---KKRQLMEL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nsrNP_001286736.1 SF1_like-KH 87..206 CDD:239088 46/120 (38%)
howNP_001262822.1 STAR_dimer 75..123 CDD:293152 13/53 (25%)
SF1_like-KH 139..260 CDD:239088 46/119 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460724
Domainoid 1 1.000 45 1.000 Domainoid score I3083
eggNOG 1 0.900 - - E1_COG5176
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D66954at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.