DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nsr and qki2

DIOPT Version :9

Sequence 1:NP_001286736.1 Gene:nsr / 37577 FlyBaseID:FBgn0034740 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_021335713.1 Gene:qki2 / 393815 ZFINID:ZDB-GENE-040426-1462 Length:341 Species:Danio rerio


Alignment Length:334 Identity:85/334 - (25%)
Similarity:141/334 - (42%) Gaps:72/334 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EEQNQDQPTQDQPTYQPRLNEVAQKFLADLDEERKRLSAEFPLCAL------LIDESVDRVFSTG 67
            |.:.:.:||.|              :|..|..::|.:|:....|.:      |:||.:.||    
Zfish     6 ETKEKPKPTPD--------------YLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEIGRV---- 52

  Fly    68 RIPGKEFYADVYHQRPMKIT--------------QKVFVPVNKFPKFNFARKILGPKGNSVRRLK 118
               .|:.|.|..:....|.|              :|::|||.::|.|||..:||||:|.:.::|:
Zfish    53 ---RKDMYNDTLNGSTDKRTSELPDAVGPIAQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLE 114

  Fly   119 EETNCKIVIKGRSSMRDRNKEEELRSSGDPRYAHLHKDLFLEVSAVAPPAECYARIAYALAEIRK 183
            .||.|||:::|:.||||:.|||:.|  |.|.:.||::||.:.::..........::..|:.|::|
Zfish   115 AETGCKIMVRGKGSMRDKKKEEQNR--GKPNWEHLNEDLHVLITVEDSQNRAEIKLKRAVEEVKK 177

  Fly   184 YLIP--DDNDDVWHEQQRELMEMNPESAKKSNGLNMAPYRSIFDKTIGGNRNGAPKYNNQIRRVT 246
            .|:|  :..|.:...|..||..:|            ..||....|        :|.....:....
Zfish   178 LLVPAAEGEDSLKKMQLMELAILN------------GTYRDANIK--------SPALAFSLAATA 222

  Fly   247 ENPREVADMEEVEYDYDEHRMPPSRPSLGFEYSKPPPSMTATNA-TPFKRAYPYPTDMNRTREPP 310
            :.||.:.....|..:.......|:.|:|     .|......|:| .|....:|..|.:.:|.|..
Zfish   223 QAPRIMTGPTPVMPNAALRTPAPTAPTL-----MPLIRQIQTSALMPTGTPHPTATLLPQTPESG 282

  Fly   311 IKSYKPNPY 319
            | .|.|..|
Zfish   283 I-IYAPYDY 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nsrNP_001286736.1 SF1_like-KH 87..206 CDD:239088 44/134 (33%)
qki2XP_021335713.1 STAR_dimer 10..68 CDD:318695 16/78 (21%)
SF1_like-KH 83..205 CDD:239088 44/135 (33%)
PRK00708 139..299 CDD:331498 39/180 (22%)
Quaking_NLS 314..341 CDD:293159
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590085
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.