DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nsr and CG3927

DIOPT Version :9

Sequence 1:NP_001286736.1 Gene:nsr / 37577 FlyBaseID:FBgn0034740 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_611681.1 Gene:CG3927 / 37576 FlyBaseID:FBgn0034739 Length:270 Species:Drosophila melanogaster


Alignment Length:267 Identity:238/267 - (89%)
Similarity:247/267 - (92%) Gaps:5/267 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 METQSEFTEEQNQDQPTQDQPTYQPRLNEVAQKFLADLDEERKRLSAEFPLCALLIDESVDRVFS 65
            |||.||.||:||     ||||||||||||||||||||||.|||||||||||||||||||||||:|
  Fly     1 METPSELTEKQN-----QDQPTYQPRLNEVAQKFLADLDAERKRLSAEFPLCALLIDESVDRVYS 60

  Fly    66 TGRIPGKEFYADVYHQRPMKITQKVFVPVNKFPKFNFARKILGPKGNSVRRLKEETNCKIVIKGR 130
            ||||||||.:||||.|:||||.|||||||||||||||..|||||||||:|||:|||:||||||||
  Fly    61 TGRIPGKEPFADVYQQKPMKIIQKVFVPVNKFPKFNFTGKILGPKGNSLRRLQEETHCKIVIKGR 125

  Fly   131 SSMRDRNKEEELRSSGDPRYAHLHKDLFLEVSAVAPPAECYARIAYALAEIRKYLIPDDNDDVWH 195
            :||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   126 NSMRDRNKEEELRSSGDPRYAHLHKDLFLEVSAVAPPAECYARIAYALAEIRKYLIPDDNDDVWH 190

  Fly   196 EQQRELMEMNPESAKKSNGLNMAPYRSIFDKTIGGNRNGAPKYNNQIRRVTENPREVADMEEVEY 260
            |||||||||||:|||||||||||||||.|||.||..||.|||||||||||||||||||.||||||
  Fly   191 EQQRELMEMNPKSAKKSNGLNMAPYRSNFDKAIGAIRNRAPKYNNQIRRVTENPREVAYMEEVEY 255

  Fly   261 DYDEHRM 267
            |||||.|
  Fly   256 DYDEHLM 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nsrNP_001286736.1 SF1_like-KH 87..206 CDD:239088 111/118 (94%)
CG3927NP_611681.1 SF1_like-KH 83..201 CDD:239088 111/117 (95%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468730
Domainoid 1 1.000 98 1.000 Domainoid score I7099
eggNOG 1 0.900 - - E1_COG5176
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I2246
Isobase 1 0.950 - 0.731683 Normalized mean entropy S1317
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 1 1.000 - - FOG0008549
OrthoInspector 1 1.000 - - otm26159
orthoMCL 1 0.900 - - OOG6_110428
Panther 1 1.100 - - P PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
1110.750

Return to query results.
Submit another query.