DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nsr and qkr58E-2

DIOPT Version :9

Sequence 1:NP_001286736.1 Gene:nsr / 37577 FlyBaseID:FBgn0034740 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001286724.1 Gene:qkr58E-2 / 37562 FlyBaseID:FBgn0022985 Length:416 Species:Drosophila melanogaster


Alignment Length:298 Identity:129/298 - (43%)
Similarity:169/298 - (56%) Gaps:33/298 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EEQNQDQPTQDQPTYQPRLNEVAQKFLADLDEERKRLSAEFPLCALLIDESVDRVFSTGRIPGKE 73
            |.:|:.....|....||.  ...||::.:|..||.|:...|||...||||:::||...||||.::
  Fly    53 EHENEHNANADGEKAQPA--PAVQKYMQELMTERSRMENHFPLAVKLIDEALERVQLNGRIPTRD 115

  Fly    74 FYADVYHQRPMKITQKVFVPVNKFPKFNFARKILGPKGNSVRRLKEETNCKIVIKGRSSMRDRNK 138
            .|||||.||.:|::|||.||: |..|||:..|:|||||||:|||:|||.|||||.||.||:||.:
  Fly   116 QYADVYQQRTIKLSQKVHVPI-KDKKFNYVGKLLGPKGNSLRRLQEETQCKIVILGRFSMKDRAR 179

  Fly   139 EEELRSSGDPRYAHLHKDLFLEVSAVAPPAECYARIAYALAEIRKYLIPDDNDDVWHEQQRELME 203
            |||||:|.|.:||||:..|.:|||.:|||||.|||:||||||||:||.||.:||:..||.|||||
  Fly   180 EEELRNSADAKYAHLNLPLHVEVSTIAPPAEAYARVAYALAEIRRYLTPDKHDDIRQEQYRELME 244

  Fly   204 MNPESAKKSNGLNMAPYRSIFDKTIGG-------------------NRNGAPKYNNQIRRVTENP 249
             :||:|||.....:....:......||                   |.||..:.....|:..:..
  Fly   245 -DPEAAKKLTLRQLQQQSNAAASGAGGGGGGGGGNGNGGAAGSGSNNGNGNQRSGGNYRQKFQQQ 308

  Fly   250 REVADMEEVEYDYDEHRMPPSRPSLGFEYSKPPPSMTA 287
            ......||..| :..|..         .|.:|.|.:.|
  Fly   309 SHYRHNEETVY-FRSHNN---------AYHQPKPYVPA 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nsrNP_001286736.1 SF1_like-KH 87..206 CDD:239088 78/118 (66%)
qkr58E-2NP_001286724.1 SF1_like-KH 129..244 CDD:239088 76/115 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468738
Domainoid 1 1.000 45 1.000 Domainoid score I3083
eggNOG 1 0.900 - - E1_COG5176
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 1 1.000 - - FOG0008549
OrthoInspector 1 1.000 - - otm26159
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.