DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nsr and qkia

DIOPT Version :9

Sequence 1:NP_001286736.1 Gene:nsr / 37577 FlyBaseID:FBgn0034740 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_571299.1 Gene:qkia / 30471 ZFINID:ZDB-GENE-990415-230 Length:383 Species:Danio rerio


Alignment Length:346 Identity:87/346 - (25%)
Similarity:149/346 - (43%) Gaps:87/346 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EEQNQDQPTQDQPTYQPRLNEVAQKFLADLDEERKRLSAEFPLCAL------LIDESVDRVFSTG 67
            |.:.:.:|:.|              :|..|..|:|.:::...||.:      |:||.::||    
Zfish     7 EVKERPRPSPD--------------YLMQLLNEKKLMTSLPNLCGIFTHLERLLDEEINRV---- 53

  Fly    68 RIPGKEFYAD----VYHQRPMK----------ITQKVFVPVNKFPKFNFARKILGPKGNSVRRLK 118
               .|:.|.|    :..:.|::          :.:|:||||.::|.:||..:||||:|.:.::|:
Zfish    54 ---RKDMYNDSVNGLVDKHPLELPEPVGPIVHLQEKLFVPVKEYPDYNFVGRILGPRGLTAKQLE 115

  Fly   119 EETNCKIVIKGRSSMRDRNKEEELRSSGDPRYAHLHKDLFLEVSAVAPPAECYARIAYALAEIRK 183
            .||.|||:::|||||||:.|||:.|  |.|.:.||::||.:.::..........::..|:.|::|
Zfish   116 AETGCKIMVRGRSSMRDKKKEEQNR--GKPNWEHLNEDLHVLITVEDTQTRAEIKMRRAVEEVKK 178

  Fly   184 YLIP--DDNDDVWHEQQRELMEMN-------------------PESAKKSNGLNMAPYRSIF-DK 226
            .|:|  :..|::...|..||..:|                   ..:|.:...|..||...:. ..
Zfish   179 LLVPAAEGEDNLKKMQLMELAILNGTYRDTNIKAPTLAFSLAAAAAAAQGPRLIAAPPGQVLPPA 243

  Fly   227 TIGGNRNGAPKYNNQIRRVTENPREVADMEEVEYDYDEHRMPPSRPSLGFEYSKPPPSMTATNAT 291
            |:...........|.||     |.::|.:           :|...|:|    ..|.|.......|
Zfish   244 TLRPPTPAGTPIMNIIR-----PTQMATV-----------LPNGTPTL----VPPTPDAGIIYTT 288

  Fly   292 PFKRAYPYPTDMNRTREPPIK 312
            |:.  |||........|.||:
Zfish   289 PYD--YPYALAPTSLLEYPIE 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nsrNP_001286736.1 SF1_like-KH 87..206 CDD:239088 46/139 (33%)
qkiaNP_571299.1 STAR_dimer 11..69 CDD:293152 16/78 (21%)
SF1_like-KH 84..206 CDD:239088 46/123 (37%)
Quaking_NLS 356..383 CDD:293159
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590109
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.