DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nsr and KHDRBS2

DIOPT Version :9

Sequence 1:NP_001286736.1 Gene:nsr / 37577 FlyBaseID:FBgn0034740 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_016865823.1 Gene:KHDRBS2 / 202559 HGNCID:18114 Length:413 Species:Homo sapiens


Alignment Length:302 Identity:99/302 - (32%)
Similarity:153/302 - (50%) Gaps:60/302 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QKFLADLDEERKRLSAEFPLCALLIDESVDRV-FSTGRIPGKE-FYADVYHQRPMKITQKVFVPV 94
            :|:|.:|..|:..|...|...:.|:.|.:::. .|.|:...:| .|.||...:.:|::::|.:||
Human     4 EKYLPELMAEKDSLDPSFVHASRLLAEEIEKFQGSDGKKEDEEKKYLDVISNKNIKLSERVLIPV 68

  Fly    95 NKFPKFNFARKILGPKGNSVRRLKEETNCKIVIKGRSSMRDRNKEEELRSSGDPRYAHLHKDLFL 159
            .::|||||..|:|||:|||::||:|||..|:.|.|:.||||:.||||||.||:.:||||..:|.:
Human    69 KQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKAKEEELRKSGEAKYAHLSDELHV 133

  Fly   160 EVSAVAPPAECYARIAYALAEIRKYLIPDDNDDVWHEQQRELMEMN-PESAKKSNGLNMAPYRSI 223
            .:...|||.|.|:|:::||.||:|:|:||.||::..||.|||..:| .|.:.:..|:.   .|.|
Human   134 LIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSEDSGRGRGIR---GRGI 195

  Fly   224 FDKTIGGNRNGAPKYNNQIRRVTENPREVADMEEVEYDYDEHRMPPSRPSLGFEYSKPPPS---- 284
                                                      |:.|:.||.|...:.|||.    
Human   196 ------------------------------------------RIAPTAPSRGRGGAIPPPPPPGR 218

  Fly   285 --MTATNATPFKRAYPYP-----TDMNRTR-EPPIKSYKPNP 318
              :|...:|..:.|.|.|     ....|.| .|.:..|:..|
Human   219 GVLTPRGSTVTRGALPVPPVARGVPTPRARGAPTVPGYRAPP 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nsrNP_001286736.1 SF1_like-KH 87..206 CDD:239088 62/119 (52%)
KHDRBS2XP_016865823.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155057
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8456
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.