DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nsr and F54D1.1

DIOPT Version :9

Sequence 1:NP_001286736.1 Gene:nsr / 37577 FlyBaseID:FBgn0034740 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_502114.1 Gene:F54D1.1 / 186227 WormBaseID:WBGene00010046 Length:278 Species:Caenorhabditis elegans


Alignment Length:272 Identity:57/272 - (20%)
Similarity:98/272 - (36%) Gaps:88/272 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LNEVAQKFLADLDEERKRLSAEFPL----CALLIDESVDRVF----------------------- 64
            |:..|..:|.:|..|.::|| |.|:    ..:|:.:.:.:||                       
 Worm     2 LSTSASLYLNELINEMRQLS-ETPIDCKNARMLLSKEISKVFDELYRHGQGFIDNGYGSDYNKND 65

  Fly    65 -----------------STGRIPGKEFYADVYHQRPM---------------------KI--TQ- 88
                             |...:|........||...|                     ||  || 
 Worm    66 FYSPHSANSGYSASPFPSRPSLPNHALSTSFYHNSFMTPIRNGRMRSPDQDLGDWSREKINDTQH 130

  Fly    89 ----KVFVPV------NKFPKFNFARKILGPKGNSVRRLKEETNCKIVIKGRSSMRDRNKEEELR 143
                ||::|.      .|..|.|:..:||||.|.|.|.::.:.:..::|:|..|:|::..:|.:|
 Worm   131 VLQTKVYIPEPPVSIDGKKVKCNYIGRILGPSGMSARMIENQYDVTLLIRGAGSVRNKAMDERVR 195

  Fly   144 SSGDPRYAHLHKDL-FLEVSAVAPPAECYARIAYALAEIRKYLIPDDNDDVWHEQQRELMEMN-- 205
            .    |..||.:.| .|.::......:|...:..|..:|...|.| .:|:...:|.....:||  
 Worm   196 K----RNEHLEEPLHVLLIARHNDKTKCEEILNKAAEKIESLLTP-IHDEYKMDQLVSYAKMNGT 255

  Fly   206 -PESAKKSNGLN 216
             .|..|:.:.|:
 Worm   256 YQERPKRKSQLD 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nsrNP_001286736.1 SF1_like-KH 87..206 CDD:239088 35/133 (26%)
F54D1.1NP_502114.1 SF1_like-KH 133..257 CDD:239088 33/128 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.731683 Normalized mean entropy S1317
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.