Sequence 1: | NP_001286736.1 | Gene: | nsr / 37577 | FlyBaseID: | FBgn0034740 | Length: | 340 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_502114.1 | Gene: | F54D1.1 / 186227 | WormBaseID: | WBGene00010046 | Length: | 278 | Species: | Caenorhabditis elegans |
Alignment Length: | 272 | Identity: | 57/272 - (20%) |
---|---|---|---|
Similarity: | 98/272 - (36%) | Gaps: | 88/272 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 LNEVAQKFLADLDEERKRLSAEFPL----CALLIDESVDRVF----------------------- 64
Fly 65 -----------------STGRIPGKEFYADVYHQRPM---------------------KI--TQ- 88
Fly 89 ----KVFVPV------NKFPKFNFARKILGPKGNSVRRLKEETNCKIVIKGRSSMRDRNKEEELR 143
Fly 144 SSGDPRYAHLHKDL-FLEVSAVAPPAECYARIAYALAEIRKYLIPDDNDDVWHEQQRELMEMN-- 205
Fly 206 -PESAKKSNGLN 216 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
nsr | NP_001286736.1 | SF1_like-KH | 87..206 | CDD:239088 | 35/133 (26%) |
F54D1.1 | NP_502114.1 | SF1_like-KH | 133..257 | CDD:239088 | 33/128 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5176 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0.731683 | Normalized mean entropy | S1317 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.760 |