DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nsr and sfa-1

DIOPT Version :9

Sequence 1:NP_001286736.1 Gene:nsr / 37577 FlyBaseID:FBgn0034740 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_503033.1 Gene:sfa-1 / 178486 WormBaseID:WBGene00013808 Length:699 Species:Caenorhabditis elegans


Alignment Length:281 Identity:68/281 - (24%)
Similarity:124/281 - (44%) Gaps:56/281 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SEFTEEQNQDQPTQDQPTYQ---PRLNEVAQKFLADLDEERKRLSAEFPLCALLIDESVDRVFST 66
            ::|...:.:::....:|.|.   .|||         ..|.|||...|     .|..|.:..:...
 Worm   236 ADFGVAEGRERSPSPEPVYDANGKRLN---------TREVRKRQELE-----QLRHEKIQALLKI 286

  Fly    67 GRIPGKEFYADVYHQRPMKITQKVFVPVNKFPKFNFARKILGPKGNSVRRLKEETNCKIVIKGRS 131
            .  |..:..|| |....:::..||::|..:||..||...::||:||:::.|:.||..||:|:|:.
 Worm   287 N--PNFKPPAD-YRAPNIRLHDKVWIPQEQFPDLNFVGLLIGPRGNTLKSLEAETGAKIIIRGKG 348

  Fly   132 SMRD---RNKEEELRSSGDPRYAHLHKDLFLEVSAVAPPAECYARIAYALAEIRKYLIPDDNDDV 193
            |:::   .|:...:....:|.:|::   ...:::.:....|   :|...:||..  .:| ||:::
 Worm   349 SIKEGKLTNRLGPMPGENEPLHAYV---TGTDMNVIKKACE---KIKQVIAEAT--ALP-DNNEL 404

  Fly   194 WHEQQRELMEMN----PESAKKSNGLNMAPYRSIFDKTIGGNRNGAPKYNNQIR----------- 243
            ...|.|||..:|    ||..  :||...:...|  |:........||...|||:           
 Worm   405 RKLQLRELALLNGTFRPEDL--ANGARCSNCGS--DEHKSWECPDAPNVTNQIKCTNCGAFGHIS 465

  Fly   244 RVTENPREV----ADMEEVEY 260
            :..:||:.:    |.|:: ||
 Worm   466 KDCKNPKGMYASEAGMDD-EY 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nsrNP_001286736.1 SF1_like-KH 87..206 CDD:239088 34/125 (27%)
sfa-1NP_503033.1 MSL5 185..422 CDD:227503 51/211 (24%)
PTZ00368 <427..>471 CDD:173561 8/45 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.731683 Normalized mean entropy S1317
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.