DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nsr and B0280.11

DIOPT Version :9

Sequence 1:NP_001286736.1 Gene:nsr / 37577 FlyBaseID:FBgn0034740 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_498560.2 Gene:B0280.11 / 175997 WormBaseID:WBGene00015106 Length:441 Species:Caenorhabditis elegans


Alignment Length:261 Identity:51/261 - (19%)
Similarity:83/261 - (31%) Gaps:102/261 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LADLDEERKRLSAEF-PLCALLID--------ESVD-------RVFSTGRIPG---KEFYADVYH 80
            |..|.|.||.|.|:| |:..:.:|        :::|       .::...|:.|   .:|:   ||
 Worm   132 LEKLVEIRKLLEADFKPIDTMKVDLEKCQAFKKNIDYCQSENVELYDANRVKGGGEADFF---YH 193

  Fly    81 QRPMKITQKVFVPVNKFPKFNFARKILG--PKGNSVRRLK-------------------EETNCK 124
                       ..|...|..:....||.  |..:|...|:                   |:...|
 Worm   194 -----------ATVTSIPSISTKSTILAQLPLSDSPHSLESFWLMVAAQKIQRLFILIGEDELDK 247

  Fly   125 IVI--------KGRSSMRDRNKEEELRSSGDPRYAHLHKDLFLEVSAVAPPAECYARIAYALAEI 181
            ..:        |...::|..|::...:|...|     :..|:.||    .|.:| |...:|:.||
 Worm   248 AALSEYFPEDFKEFKTIRVNNRKTVSKSDEQP-----NTQLYYEV----VPKDC-AEAPFAMIEI 302

  Fly   182 RKYLIPDDNDDVWHEQQRELMEMNPESAKKSNGLNMAPYRSIFDKTI------------GGNRNG 234
                     .|.|.:.:...:         |.|...|...|:||..|            |..|.|
 Worm   303 ---------CDFWPDGKIPTV---------SYGRIAATAASVFDSDIDSDATCAIVSNYGAGRAG 349

  Fly   235 A 235
            :
 Worm   350 S 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nsrNP_001286736.1 SF1_like-KH 87..206 CDD:239088 25/147 (17%)
B0280.11NP_498560.2 PTPc 141..398 CDD:214550 46/252 (18%)
PTPc 177..394 CDD:304379 40/216 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.731683 Normalized mean entropy S1317
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.