DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nsr and khdrbs3

DIOPT Version :9

Sequence 1:NP_001286736.1 Gene:nsr / 37577 FlyBaseID:FBgn0034740 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_009296555.1 Gene:khdrbs3 / 101867535 ZFINID:ZDB-GENE-130530-892 Length:305 Species:Danio rerio


Alignment Length:284 Identity:85/284 - (29%)
Similarity:127/284 - (44%) Gaps:75/284 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 KFNFARKILGPKGNSVRRLKEETNCKIVIKGRSSMRDRNKEEELRSSGDPRYAHLHKDLFLEVSA 163
            :|||..|:|||:|||::||:|:|..|:.|.|:.||||:.||||||.||:.:|.||::||.:.:..
Zfish    33 QFNFVGKLLGPRGNSLKRLQEDTLTKMSILGKGSMRDKEKEEELRKSGETKYHHLNEDLHVLIEV 97

  Fly   164 VAPPAECYARIAYALAEIRKYLIPDDNDDVWHEQQRELMEMNPESAKKSNGLNMAPYRSIFDKTI 228
            .|||||.|||:.:||.||:|:||||.||::...|.:||..:|       .|...|...:...||.
Zfish    98 FAPPAEAYARMGHALEEIKKFLIPDYNDEIRQAQLQELTYLN-------GGSEDAKVPAARGKTT 155

  Fly   229 GGNRNGAPKYNNQIRRVTENPREVADMEEVEYDYDEHRMPPSR-------------PSLGFEYSK 280
            ...|..:....::.|.....|:...............|:|.||             |..|:   :
Zfish   156 TRGRGTSAPGTHRTRGGVPPPQAAVPRGAAPRGAPPSRVPSSRGVAVSSRRARGAPPPPGY---R 217

  Fly   281 PPPSMT--------------------------------ATNATPFKRAYPY-----------PTD 302
            |||::.                                |.|:..:   |.|           |.:
Zfish   218 PPPAVVQDTYGEYEYDDGYGTAYDDQGYDSYDNNYNNQAQNSDDY---YEYGISGDSYDSYGPEE 279

  Fly   303 M--NRTREPPIKS----YKPNPYT 320
            .  ||.:.||.::    |:..||:
Zfish   280 WTNNRNKAPPARTSKGVYRDQPYS 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nsrNP_001286736.1 SF1_like-KH 87..206 CDD:239088 56/106 (53%)
khdrbs3XP_009296555.1 SF1_like-KH 34..141 CDD:239088 57/113 (50%)
Sam68-YY 227..279 CDD:293176 5/54 (9%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590093
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26159
orthoMCL 1 0.900 - - OOG6_110428
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.