DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3927 and QKI

DIOPT Version :9

Sequence 1:NP_611681.1 Gene:CG3927 / 37576 FlyBaseID:FBgn0034739 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_006766.1 Gene:QKI / 9444 HGNCID:21100 Length:341 Species:Homo sapiens


Alignment Length:214 Identity:63/214 - (29%)
Similarity:109/214 - (50%) Gaps:38/214 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EKQNQDQPTYQPRLNEVAQKFLADLDAERKRLSAEFPLCAL------LIDESVDRVYSTGRIPGK 67
            |.:.:::|...|       .:|..|..::|.:|:....|.:      |:||.:.||       .|
Human     4 EMETKEKPKPTP-------DYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRV-------RK 54

  Fly    68 EPFADVYQQKPMK-----------IIQ---KVFVPVNKFPKFNFTGKILGPKGNSLRRLQEETHC 118
            :.:.|.......|           |:|   |::|||.::|.|||.|:||||:|.:.::|:.||.|
Human    55 DMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGC 119

  Fly   119 KIVIKGRNSMRDRNKEEELRSSGDPRYAHLHKDLFLEVSAVAPPAECYARIAYALAEIRKYLIP- 182
            ||:::|:.||||:.|||:.|  |.|.:.||::||.:.::..........::..|:.|::|.|:| 
Human   120 KIMVRGKGSMRDKKKEEQNR--GKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPA 182

  Fly   183 -DDNDDVWHEQQRELMEMN 200
             :..|.:...|..||..:|
Human   183 AEGEDSLKKMQLMELAILN 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3927NP_611681.1 SF1_like-KH 83..201 CDD:239088 46/123 (37%)
QKINP_006766.1 STAR_dimer 10..66 CDD:406848 14/69 (20%)
Qua1 domain, involved in homodimerization. /evidence=ECO:0000250|UniProtKB:Q17339 11..82 16/84 (19%)
KH-I_Hqk 81..183 CDD:411893 41/103 (40%)
Qua2 domain, involved in RNA binding. /evidence=ECO:0000269|PubMed:23630077 182..213 5/20 (25%)
PHA03247 <211..314 CDD:223021
SH3-binding 276..279
Quaking_NLS 312..341 CDD:406855
Nuclear localization signal. /evidence=ECO:0000250 324..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155042
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.