DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3927 and MSL5

DIOPT Version :9

Sequence 1:NP_611681.1 Gene:CG3927 / 37576 FlyBaseID:FBgn0034739 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_013217.1 Gene:MSL5 / 850807 SGDID:S000004106 Length:476 Species:Saccharomyces cerevisiae


Alignment Length:308 Identity:75/308 - (24%)
Similarity:117/308 - (37%) Gaps:91/308 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PSELTEKQNQDQPTYQ---PRLNEVAQKFLADLDAERKRLSAEFPLCALLIDESVDRVYSTGRIP 65
            |.....:.....|.|.   .|.|...|::...|:.||.:|              |:....|  ||
Yeast    86 PPSRKNRSPSPPPVYDAQGKRTNTREQRYRKKLEDERIKL--------------VEIALKT--IP 134

  Fly    66 GKEPFADVYQQKPMKIIQKVFVPVNKFPKFNFTGKILGPKGNSLRRLQEETHCKIVIKGRNSMRD 130
            ...| .|.| ::|.|...|.::||:::|..||.|.:|||:|.:||:|||:::|||.|:||.|:::
Yeast   135 YFVP-PDDY-KRPTKFQDKYYIPVDQYPDVNFVGLLLGPRGRTLRKLQEDSNCKIAIRGRGSVKE 197

  Fly   131 RNKEEELRSSGDPRYAHLHKDLFLEVSAVAPPAECYARIAYALAEIRKYL------------IPD 183
            .....:|     |..|...:|          |..|.. ||.:..:|:|.:            .|:
Yeast   198 GKNASDL-----PPGAMNFED----------PLHCLI-IADSEDKIQKGIKVCQNIVIKAVTSPE 246

  Fly   184 DNDDVWHEQQRELMEMNP--------------KSAKK-------------------------SNG 209
            ..:|:...|.|||.|:|.              |..|:                         |..
Yeast   247 GQNDLKRGQLRELAELNGTLREDNRPCPICGLKDHKRYDCPNRKIPNIQGIVCKICGQTGHFSRD 311

  Fly   210 LNMAPYR-SNFDKAIGAIRNRAPKYNNQIRRVTENPREVAYMEEVEYD 256
            .|.:..| |.||:. ..:.|.||..:|.: ....|...:...:...||
Yeast   312 CNSSSQRMSRFDRN-ATVNNSAPIQSNDV-HYNSNTHPIQAPKRSRYD 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3927NP_611681.1 SF1_like-KH 83..201 CDD:239088 40/129 (31%)
MSL5NP_013217.1 MSL5 1..269 CDD:227503 60/216 (28%)
AIR1 <267..386 CDD:227414 15/93 (16%)
PHA03247 <363..435 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3083
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.731683 Normalized mean entropy S1317
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.