DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3927 and AT1G09660

DIOPT Version :9

Sequence 1:NP_611681.1 Gene:CG3927 / 37576 FlyBaseID:FBgn0034739 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001320903.1 Gene:AT1G09660 / 837494 AraportID:AT1G09660 Length:298 Species:Arabidopsis thaliana


Alignment Length:240 Identity:69/240 - (28%)
Similarity:112/240 - (46%) Gaps:54/240 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QKFLADLDAERKRLS---AEFPLCALLIDESVDRVYS---TGRIPGKEPFADVYQ---------- 75
            :::|.:|..||::|.   ...|.|..|::..:.||.|   ..|.....||..:.|          
plant    43 ERYLTELLQERQKLGPFLQVMPNCCRLLNHEIRRVSSFPDLDRYEHGSPFRSLGQPTNGKLDLEG 107

  Fly    76 --------------QKPMK-----------------IIQKVF---VPVNKFPKFNFTGKILGPKG 106
                          ..|.:                 |::||.   |||:|:|.:||.|:||||:|
plant   108 WSMMQAEENCHLQRASPFRGPSPVGWIGMPGLPNPPIVKKVIRLDVPVDKYPSYNFVGRILGPRG 172

  Fly   107 NSLRRLQEETHCKIVIKGRNSMRDRNKEEELRSSGDPRYAHLHKDLFLEVSAVAPPAECYARIAY 171
            |||:|::..|||::.|:||.|::|..|||:|:  |.|.|.||.:.|.:.:.|..|.....:|:.:
plant   173 NSLKRVELATHCRVFIRGRGSVKDTVKEEKLK--GKPGYEHLCEPLHVLIEAELPEDIINSRLEH 235

  Fly   172 ALAEIRKYLIPDDN--DDVWHEQQRELMEMNPKSAKKSNGLNMAP 214
            |:..:...|.|.|.  |....||.:||..:|....::|...:::|
plant   236 AVHFLESLLKPMDESMDHYKREQLKELAALNGTLREESPSPSLSP 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3927NP_611681.1 SF1_like-KH 83..201 CDD:239088 49/122 (40%)
AT1G09660NP_001320903.1 STAR_dimer 45..90 CDD:406848 12/44 (27%)
KH-I 146..246 CDD:412160 42/101 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I2246
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.