DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3927 and AT3G08620

DIOPT Version :9

Sequence 1:NP_611681.1 Gene:CG3927 / 37576 FlyBaseID:FBgn0034739 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_187474.2 Gene:AT3G08620 / 820009 AraportID:AT3G08620 Length:283 Species:Arabidopsis thaliana


Alignment Length:262 Identity:66/262 - (25%)
Similarity:122/262 - (46%) Gaps:64/262 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PTYQPRLNEVAQKFLADLDAERKRLS---AEFPLCALLIDESVDRVYSTGRIPGKEPFADVYQQK 77
            |..:...::|..::::.|.||.::|.   ...|:|:.|:::.:.|:  ||.:| .:.|.|..:.:
plant    18 PQIRTPSSDVDSQYISQLLAEHQKLGPFMQVLPICSRLLNQEIFRI--TGMMP-NQGFTDFDRLR 79

  Fly    78 ----------------------------------------------------PMKIIQKVFVPVN 90
                                                                |:|.|.::.:||:
plant    80 HRSPSPMASPNLMSNVSGGGLGGWNGLPPERIGGPHGMAMEWQGAPASPSSYPVKRILRLDLPVD 144

  Fly    91 KFPKFNFTGKILGPKGNSLRRLQEETHCKIVIKGRNSMRDRNKEEELRSSGDPRYAHLHKDLFLE 155
            .:|.|||.|::|||:||||:|::..|.|::.|:|:.|::|..|||:|:  |.|.|.||::.|.:.
plant   145 TYPNFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDPEKEEKLK--GKPGYEHLNEQLHIL 207

  Fly   156 VSAVAPPAECYARIAYALAEIRKYLIPDD--NDDVWHEQQRELMEMNPKSAKKSNGL--NMAPYR 216
            :.|..|......::..|...|.:.:.|.|  .|.:..:|.|||..:|....:.|.|.  :::|:.
plant   208 IEADLPIDIVDIKLRQAQEIIEELVKPVDESQDYIKRQQLRELALLNSNLRENSPGPSGSVSPFN 272

  Fly   217 SN 218
            ||
plant   273 SN 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3927NP_611681.1 SF1_like-KH 83..201 CDD:239088 42/119 (35%)
AT3G08620NP_187474.2 STAR_dimer 28..74 CDD:406848 12/48 (25%)
KH-I 134..234 CDD:412160 37/101 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4142
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I2246
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.