DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3927 and khdrbs2

DIOPT Version :9

Sequence 1:NP_611681.1 Gene:CG3927 / 37576 FlyBaseID:FBgn0034739 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001072215.1 Gene:khdrbs2 / 779662 XenbaseID:XB-GENE-490722 Length:345 Species:Xenopus tropicalis


Alignment Length:176 Identity:77/176 - (43%)
Similarity:119/176 - (67%) Gaps:2/176 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QKFLADLDAERKRLSAEFPLCALLIDESVDRVYST--GRIPGKEPFADVYQQKPMKIIQKVFVPV 89
            :|:|.:|.||:..|...|.....|:||.:.:...:  .:..|::.:.|:...|.:|:.::|.:||
 Frog     4 EKYLPELMAEKDSLDPSFVHAMRLLDEEIVKFQDSEGNKEDGEKKYLDIISNKNIKLSERVLIPV 68

  Fly    90 NKFPKFNFTGKILGPKGNSLRRLQEETHCKIVIKGRNSMRDRNKEEELRSSGDPRYAHLHKDLFL 154
            .::|||||.||:|||:||||:||||||..|:.|.|:.||||:.||||||.|.:.::|||..:|.:
 Frog    69 KQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKIKEEELRKSDEAKHAHLSDELHV 133

  Fly   155 EVSAVAPPAECYARIAYALAEIRKYLIPDDNDDVWHEQQRELMEMN 200
            .:...|||.|.|:|:::||.||:|:|:||.||::..||.|||..:|
 Frog   134 LLEVFAPPGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLN 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3927NP_611681.1 SF1_like-KH 83..201 CDD:239088 63/118 (53%)
khdrbs2NP_001072215.1 Qua1 5..57 CDD:374463 12/51 (24%)
SF1_like-KH 61..180 CDD:239088 63/119 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..224 1/2 (50%)
Sam68-YY 263..317 CDD:374636
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 321..345
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10668
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 180 1.000 Inparanoid score I3883
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9347
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.