DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3927 and khdrbs2

DIOPT Version :9

Sequence 1:NP_611681.1 Gene:CG3927 / 37576 FlyBaseID:FBgn0034739 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001070758.1 Gene:khdrbs2 / 768147 ZFINID:ZDB-GENE-061013-497 Length:346 Species:Danio rerio


Alignment Length:191 Identity:82/191 - (42%)
Similarity:123/191 - (64%) Gaps:12/191 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KFLADLDAERKRLSAEFPLCALLIDESV-----DRVYSTGRIPGKEPFADVYQQKPMKIIQKVFV 87
            |:|.:|.||::.|.|.|.....|:.|.:     |.:...|.:   :.:.|:...|.:|:.::|.:
Zfish     5 KYLPELVAEKESLDASFVHAMRLLAEEIEKFEGDELRKDGEV---KKYLDIISNKNIKLSERVLI 66

  Fly    88 PVNKFPKFNFTGKILGPKGNSLRRLQEETHCKIVIKGRNSMRDRNKEEELRSSGDPRYAHLHKDL 152
            ||.::|||||.||:|||:|||::||||||..|:.|.|:.||||:.||||||.||:.:||||..||
Zfish    67 PVQQYPKFNFVGKLLGPRGNSMKRLQEETGAKMSILGKGSMRDKGKEEELRKSGEAKYAHLSNDL 131

  Fly   153 FLEVSAVAPPAECYARIAYALAEIRKYLIPDDNDDVWHEQQRELMEMN----PKSAKKSNG 209
            .:.:...|||.|.|:|:::||.||:|:|:||.||::..||.|||..:|    |...:.:.|
Zfish   132 HVLIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSDDPSRGRSARG 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3927NP_611681.1 SF1_like-KH 83..201 CDD:239088 65/121 (54%)
khdrbs2NP_001070758.1 Qua1 6..57 CDD:292891 12/53 (23%)
SF1_like-KH 61..180 CDD:239088 64/118 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..292 4/18 (22%)
Sam68-YY <281..>306 CDD:293176
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590102
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26159
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.