DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3927 and Khdrbs3

DIOPT Version :9

Sequence 1:NP_611681.1 Gene:CG3927 / 37576 FlyBaseID:FBgn0034739 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_071585.2 Gene:Khdrbs3 / 64015 RGDID:620921 Length:346 Species:Rattus norvegicus


Alignment Length:275 Identity:98/275 - (35%)
Similarity:139/275 - (50%) Gaps:46/275 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QKFLADLDAERKRLSAEFPLCALLIDESVDRVYSTGRIPGKEPFADVYQQKPMKIIQKVFVPVNK 91
            :|:|.:|.||:..|...|.....|::..::: :..|....:|.:.||...|.||:.|||.:||.:
  Rat     3 EKYLPELMAEKDSLDPSFTHALRLVNREIEK-FQKGEAKDEEKYIDVVINKNMKLGQKVLIPVKQ 66

  Fly    92 FPKFNFTGKILGPKGNSLRRLQEETHCKIVIKGRNSMRDRNKEEELRSSGDPRYAHLHKDLFLEV 156
            ||||||.||:|||:||||:||||||..|:.|.|:.||||:.||||||.||:.:|.||:.||.:.:
  Rat    67 FPKFNFVGKLLGPRGNSLKRLQEETLTKMSILGKGSMRDKAKEEELRKSGEAKYFHLNDDLHVLI 131

  Fly   157 SAVAPPAECYARIAYALAEIRKYLIPDDNDDVWHEQQRELMEMN--------------------- 200
            ...|||||.|||:.:||.||:|:||||.||::...|.:||..:|                     
  Rat   132 EVFAPPAEAYARMGHALEEIKKFLIPDYNDEIRQAQLQELTYLNGGSENADVPVVRGKSTLRTRG 196

  Fly   201 ---PKSAKKSNGLNMAPYRSNFDKAI----GAIRNRAPKYNNQ--------------IRRVTENP 244
               |...:...|:...|......:..    |.:..|.|....:              .|.....|
  Rat   197 VTTPAITRGRGGVTARPVAVGVPRGTPTPRGVLSTRGPVSRGRGLLTPRARGVPPTGYRPPPPPP 261

  Fly   245 REVAYMEEVEYDYDE 259
            .:..|   .|||||:
  Rat   262 TQETY---GEYDYDD 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3927NP_611681.1 SF1_like-KH 83..201 CDD:239088 69/141 (49%)
Khdrbs3NP_071585.2 Involved in homodimerization. /evidence=ECO:0000250|UniProtKB:O75525 1..160 78/157 (50%)
Qua1 4..53 CDD:406639 12/49 (24%)
KH-I_KHDRBS3 48..160 CDD:411898 67/111 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..268 7/58 (12%)
Sam68-YY 266..320 CDD:406871 6/11 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 320..346
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348924
Domainoid 1 1.000 54 1.000 Domainoid score I10913
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I4063
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8931
orthoMCL 1 0.900 - - OOG6_110428
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.760

Return to query results.
Submit another query.