DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3927 and khdrbs1

DIOPT Version :9

Sequence 1:NP_611681.1 Gene:CG3927 / 37576 FlyBaseID:FBgn0034739 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001017045.1 Gene:khdrbs1 / 549799 XenbaseID:XB-GENE-479347 Length:360 Species:Xenopus tropicalis


Alignment Length:197 Identity:78/197 - (39%)
Similarity:121/197 - (61%) Gaps:11/197 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EVAQKFLADLDAERKRLSAEFPLCALLIDESVDRVYSTG--RIPGKEPFADVYQQKPMKIIQKVF 86
            |...|:|.:|.||:..|...|.....|:.:.::|:...|  :...::.:.|::..|.||:.:::.
 Frog     2 ETETKYLPELMAEKDSLDPSFTHAMSLLGKEIERLKKGGDAKKDEEDTYLDLFSHKNMKLKERIL 66

  Fly    87 VPVNKFPKFNFTGKILGPKGNSLRRLQEETHCKIVIKGRNSMRDRNKEEELRSSGDPRYAHLHKD 151
            :||..:|||||.||||||:||:::||||||..||.:.|:.||||:.||||||..|||:|:||:.|
 Frog    67 IPVKLYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYSHLNMD 131

  Fly   152 LFLEVSAVAPPAECYARIAYALAEIRKYLIP---------DDNDDVWHEQQRELMEMNPKSAKKS 207
            |.:.:....||.|.|.|:|:|:.|::|:|:|         |..||:..||..||..:|....::|
 Frog   132 LHVFIEVFGPPCESYTRMAHAMEEVKKFLVPLTPESFSYQDMMDDICQEQFMELSYLNGAPPEQS 196

  Fly   208 NG 209
            .|
 Frog   197 RG 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3927NP_611681.1 SF1_like-KH 83..201 CDD:239088 60/126 (48%)
khdrbs1NP_001017045.1 Qua1 6..58 CDD:406639 11/51 (22%)
KH-I 57..162 CDD:412160 55/104 (53%)
Sam68-YY 282..331 CDD:406871
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 180 1.000 Inparanoid score I3883
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9347
Panther 1 1.100 - - O PTHR11208
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.160

Return to query results.
Submit another query.