DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3927 and SF1

DIOPT Version :9

Sequence 1:NP_611681.1 Gene:CG3927 / 37576 FlyBaseID:FBgn0034739 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_524654.2 Gene:SF1 / 43912 FlyBaseID:FBgn0025571 Length:787 Species:Drosophila melanogaster


Alignment Length:207 Identity:49/207 - (23%)
Similarity:100/207 - (48%) Gaps:40/207 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LTEKQNQDQPTYQP-------RLNEVAQKFLADLDAERKRLSAEFPLCALLIDESVDRVYSTGRI 64
            :|:...:..|:.:|       |||....::...|:.:|.:|..:.        ::|:        
  Fly   327 ITQNPEERSPSPEPIYSSDGKRLNTREFRYRKRLEEQRHQLIVKM--------QTVN-------- 375

  Fly    65 PGKEPFADVYQQKPMKIIQKVFVPVNKFPKFNFTGKILGPKGNSLRRLQEETHCKIVIKGRNSMR 129
            |..:|.|| |:....::..||.:|..:.|..||.|.::||:||:|:.::::|..||:|:|:.|::
  Fly   376 PEFKPPAD-YKPPVTRVSDKVLIPQEQHPDINFVGLLIGPRGNTLKAMEKDTGAKIIIRGKGSVK 439

  Fly   130 D----RNKEEELRSSGDPRYAHLHKDLFLEVSAVAPPAECYARIAYALAE-IRKYL-IPDDNDDV 188
            :    |...:.|....:|.:|.:          .||..|...:....:.: ||:.: :|:.::|:
  Fly   440 EGKVGRKDGQPLPGEDEPLHAFI----------TAPNPEAVRKAVDKIKDVIRQGIEVPEGHNDL 494

  Fly   189 WHEQQRELMEMN 200
            ...|.|||.::|
  Fly   495 RRMQLRELAQLN 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3927NP_611681.1 SF1_like-KH 83..201 CDD:239088 34/124 (27%)
SF1NP_524654.2 MSL5 253..512 CDD:227503 49/207 (24%)
SF1-HH 274..385 CDD:292892 14/74 (19%)
SF1_like-KH 392..510 CDD:239088 34/125 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460733
Domainoid 1 1.000 45 1.000 Domainoid score I3083
eggNOG 1 0.900 - - E1_COG5176
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.