DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3927 and qki2

DIOPT Version :9

Sequence 1:NP_611681.1 Gene:CG3927 / 37576 FlyBaseID:FBgn0034739 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_021335713.1 Gene:qki2 / 393815 ZFINID:ZDB-GENE-040426-1462 Length:341 Species:Danio rerio


Alignment Length:215 Identity:63/215 - (29%)
Similarity:111/215 - (51%) Gaps:40/215 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EKQNQDQPTYQPRLNEVAQKFLADLDAERKRLSAEFPLCAL------LIDESVDRV----YS--- 60
            |.:.:::|...|       .:|..|..::|.:|:....|.:      |:||.:.||    |:   
Zfish     4 EMETKEKPKPTP-------DYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEIGRVRKDMYNDTL 61

  Fly    61 -------TGRIP-GKEPFADVYQQKPMKIIQKVFVPVNKFPKFNFTGKILGPKGNSLRRLQEETH 117
                   |..:| ...|.|        ::.:|::|||.::|.|||.|:||||:|.:.::|:.||.
Zfish    62 NGSTDKRTSELPDAVGPIA--------QLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETG 118

  Fly   118 CKIVIKGRNSMRDRNKEEELRSSGDPRYAHLHKDLFLEVSAVAPPAECYARIAYALAEIRKYLIP 182
            |||:::|:.||||:.|||:.|  |.|.:.||::||.:.::..........::..|:.|::|.|:|
Zfish   119 CKIMVRGKGSMRDKKKEEQNR--GKPNWEHLNEDLHVLITVEDSQNRAEIKLKRAVEEVKKLLVP 181

  Fly   183 --DDNDDVWHEQQRELMEMN 200
              :..|.:...|..||..:|
Zfish   182 AAEGEDSLKKMQLMELAILN 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3927NP_611681.1 SF1_like-KH 83..201 CDD:239088 45/120 (38%)
qki2XP_021335713.1 STAR_dimer 10..68 CDD:318695 13/64 (20%)
SF1_like-KH 83..205 CDD:239088 45/121 (37%)
PRK00708 139..299 CDD:331498 17/65 (26%)
Quaking_NLS 314..341 CDD:293159
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590086
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.