DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3927 and CG10384

DIOPT Version :9

Sequence 1:NP_611681.1 Gene:CG3927 / 37576 FlyBaseID:FBgn0034739 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001163254.2 Gene:CG10384 / 37567 FlyBaseID:FBgn0034731 Length:492 Species:Drosophila melanogaster


Alignment Length:139 Identity:79/139 - (56%)
Similarity:103/139 - (74%) Gaps:0/139 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 DVYQQKPMKIIQKVFVPVNKFPKFNFTGKILGPKGNSLRRLQEETHCKIVIKGRNSMRDRNKEEE 136
            |:.:.||:|:..||.|||...|||||.||:|||||||::||||:|.||:.:.||.|||||.||||
  Fly    25 DITRDKPVKVAVKVAVPVRDHPKFNFVGKLLGPKGNSMKRLQEDTMCKMAVLGRGSMRDRRKEEE 89

  Fly   137 LRSSGDPRYAHLHKDLFLEVSAVAPPAECYARIAYALAEIRKYLIPDDNDDVWHEQQRELMEMNP 201
            ||.|||.|||||.:||.:|:|..|.|||.:|||||||||:|::|:||.:||:..||..|:..:..
  Fly    90 LRGSGDSRYAHLFEDLHVEISTFAAPAEAHARIAYALAEVRRFLVPDYHDDIRQEQMWEMQALTS 154

  Fly   202 KSAKKSNGL 210
            ..|..::.|
  Fly   155 TPALGAHSL 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3927NP_611681.1 SF1_like-KH 83..201 CDD:239088 73/117 (62%)
CG10384NP_001163254.2 SF1_like-KH 44..155 CDD:239088 68/110 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468754
Domainoid 1 1.000 45 1.000 Domainoid score I3083
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26159
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.