DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3927 and qkr58E-1

DIOPT Version :9

Sequence 1:NP_611681.1 Gene:CG3927 / 37576 FlyBaseID:FBgn0034739 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_523809.2 Gene:qkr58E-1 / 37561 FlyBaseID:FBgn0022986 Length:396 Species:Drosophila melanogaster


Alignment Length:243 Identity:113/243 - (46%)
Similarity:160/243 - (65%) Gaps:19/243 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PRLNEVAQKFLADLDAERKRLSAEFPLCALLIDESVDRVYSTGRIPGKEPFADVYQQKPMKIIQK 84
            |:|||....:|.:...|:|.|..:..:...|:|:.|:::..:||||..|.:|:||.:||:::.||
  Fly    52 PQLNEKTNAYLQECLLEKKTLEKKHIITKRLLDDEVEKILVSGRIPKPEIYANVYSEKPIRVAQK 116

  Fly    85 VFVPVNKFPKFNFTGKILGPKGNSLRRLQEETHCKIVIKGRNSMRDRNKEEELRSSGDPRYAHLH 149
            |..|:.::|||||.|||||||||:||:|||||.||:|:.|||||||..|||||||||:|:||||.
  Fly   117 VLFPIKEYPKFNFVGKILGPKGNTLRQLQEETMCKMVVMGRNSMRDHGKEEELRSSGNPKYAHLS 181

  Fly   150 KDLFLEVSAVAPPAECYARIAYALAEIRKYLIPDDNDDVWHEQQRELMEMNPKSAKKSNGLNMAP 214
            :||.:|:|.||||||.|.||:|||.||||::|||.|||:..||.|| |:...:..|||:      
  Fly   182 RDLHVEISTVAPPAEAYHRISYALGEIRKFMIPDANDDIRLEQLRE-MDGKERMYKKSH------ 239

  Fly   215 YRSNFDKAI---GAIRNRAPKYNNQIRRVTENPREVAYMEEVEYDYDE 259
               ::.|:.   ||..:|.|.      ..:..|:..:.:|:..|..|:
  Fly   240 ---HYSKSYGDHGAYSSRTPP------PASSKPKVYSILEKARYVMDD 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3927NP_611681.1 SF1_like-KH 83..201 CDD:239088 80/117 (68%)
qkr58E-1NP_523809.2 KH-I 109..210 CDD:412160 69/100 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468743
Domainoid 1 1.000 45 1.000 Domainoid score I3083
eggNOG 1 0.900 - - E1_COG5176
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I2246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 1 1.000 - - FOG0008549
OrthoInspector 1 1.000 - - otm26159
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.