DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3927 and CG4021

DIOPT Version :9

Sequence 1:NP_611681.1 Gene:CG3927 / 37576 FlyBaseID:FBgn0034739 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster


Alignment Length:270 Identity:197/270 - (72%)
Similarity:223/270 - (82%) Gaps:11/270 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 METPSELTEKQNQDQPTYQPRLNEVAQKFLADLDAERKRLSAEFPLCALLIDESVDRVYSTGRIP 65
            ||.|||:||:|......|||||||:|||||||||.||:|||||||||||||||:.||||:|||||
  Fly     4 MENPSEITEEQPTTTHEYQPRLNEIAQKFLADLDEERQRLSAEFPLCALLIDEARDRVYATGRIP 68

  Fly    66 GKEPFADVYQQKPMKIIQKVFVPVNKFPKFNFTGKILGPKGNSLRRLQEETHCKIVIKGRNSMRD 130
            |||.:||||:|||||||||||||||::|||||.||||||||||||||||||.|||.:|||:||||
  Fly    69 GKELYADVYRQKPMKIIQKVFVPVNQYPKFNFAGKILGPKGNSLRRLQEETQCKIALKGRSSMRD 133

  Fly   131 RNKEEELRSSGDPRYAHLHKDLFLEVSAVAPPAECYARIAYALAEIRKYLIPDDNDDVWHEQQRE 195
            |||||||||  |||||||.|:||||||.||.||||::||||||||||||||||:||:|.|||.||
  Fly   134 RNKEEELRS--DPRYAHLQKNLFLEVSTVAIPAECHSRIAYALAEIRKYLIPDNNDEVSHEQLRE 196

  Fly   196 LMEMNPKSAKKSNGLNMAPYRSNFDKAIGAIRNRAPKYNNQIRRVTENPREVAYMEEVEYDYDEH 260
            |||::|:|||...|||:..|||..|.      |.|.||.|.|:||.|||.:||.||:|:||||||
  Fly   197 LMEIDPESAKNFKGLNLEAYRSVRDS------NGASKYINLIKRVAENPSKVADMEQVDYDYDEH 255

  Fly   261 LMFCSPVVRL 270
            .|   |.:.|
  Fly   256 HM---PPIHL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3927NP_611681.1 SF1_like-KH 83..201 CDD:239088 97/117 (83%)
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 97/117 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468734
Domainoid 1 1.000 54 1.000 Domainoid score I4142
eggNOG 1 0.900 - - E1_COG5176
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I2246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D428083at33208
OrthoFinder 1 1.000 - - FOG0008549
OrthoInspector 1 1.000 - - otm26159
orthoMCL 1 0.900 - - OOG6_110428
Panther 1 1.100 - - P PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.