DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3927 and qkr54B

DIOPT Version :10

Sequence 1:NP_611681.1 Gene:CG3927 / 37576 FlyBaseID:FBgn0034739 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001261050.1 Gene:qkr54B / 36966 FlyBaseID:FBgn0022987 Length:617 Species:Drosophila melanogaster


Alignment Length:57 Identity:13/57 - (22%)
Similarity:21/57 - (36%) Gaps:15/57 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   514 DTATAALLSSYNGAAAHQHQMLQQPCNNALMSNSLAMAYRNQNNFMTNSHQQQCGGY 570
            :|..:|:|         |...:.|||...|:  .|...:|.    :..:..|.|..|
  Fly    56 NTTESAIL---------QADTIGQPCRVLLL--ELLKIFRT----IGQAELQACAAY 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3927NP_611681.1 KH-I_KHDRBS 77..178 CDD:411812
qkr54BNP_001261050.1 Qua1 68..118 CDD:465079 9/36 (25%)
KH-I_KHDRBS 117..218 CDD:411812
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.