| Sequence 1: | NP_611681.1 | Gene: | CG3927 / 37576 | FlyBaseID: | FBgn0034739 | Length: | 270 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001261050.1 | Gene: | qkr54B / 36966 | FlyBaseID: | FBgn0022987 | Length: | 617 | Species: | Drosophila melanogaster |
| Alignment Length: | 57 | Identity: | 13/57 - (22%) |
|---|---|---|---|
| Similarity: | 21/57 - (36%) | Gaps: | 15/57 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 514 DTATAALLSSYNGAAAHQHQMLQQPCNNALMSNSLAMAYRNQNNFMTNSHQQQCGGY 570 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG3927 | NP_611681.1 | KH-I_KHDRBS | 77..178 | CDD:411812 | |
| qkr54B | NP_001261050.1 | Qua1 | 68..118 | CDD:465079 | 9/36 (25%) |
| KH-I_KHDRBS | 117..218 | CDD:411812 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||