DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3927 and Sf1

DIOPT Version :9

Sequence 1:NP_611681.1 Gene:CG3927 / 37576 FlyBaseID:FBgn0034739 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001104261.1 Gene:Sf1 / 22668 MGIID:1095403 Length:639 Species:Mus musculus


Alignment Length:232 Identity:57/232 - (24%)
Similarity:106/232 - (45%) Gaps:43/232 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PSELTEKQNQDQPTYQ---PRLNEVAQKFLADLDAERKRLSAEFPLCALLIDESVDRVYSTGRIP 65
            |....::....:|.|.   .|||....:....|:.||..|..|  :.||              .|
Mouse    73 PPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHTLITE--MVAL--------------NP 121

  Fly    66 GKEPFADVYQQKPMKIIQKVFVPVNKFPKFNFTGKILGPKGNSLRRLQEETHCKIVIKGRNSMRD 130
            ..:|.|| |:....::..||.:|.:::|:.||.|.::||:||:|:.:::|.:.||:|:|:.|:::
Mouse   122 DFKPPAD-YKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKE 185

  Fly   131 ----RNKEEELRSSGDPRYAHLHKDLFLEVSAVAPPAECYARIAYALAEIRKYL-----IPDDND 186
                |...:.|....:|.:|.:             .|.....:..|:.:||..|     .|:|.:
Mouse   186 GKVGRKDGQMLPGEDEPLHALV-------------TANTMENVKKAVEQIRNILKQGIETPEDQN 237

  Fly   187 DVWHEQQRELMEMNPKSAKKSNGLNMAPYRSNFDKAI 223
            |:...|.|||..:|....:..|.: :.|::|:..::|
Mouse   238 DLRKMQLRELARLNGTLREDDNRI-LRPWQSSETRSI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3927NP_611681.1 SF1_like-KH 83..201 CDD:239088 34/126 (27%)
Sf1NP_001104261.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44
Nuclear localization signal. /evidence=ECO:0000255 15..19
MSL5 17..257 CDD:227503 53/213 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..94 3/20 (15%)
ZnF_C2HC 278..293 CDD:197667
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 325..584
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.731683 Normalized mean entropy S1317
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.