DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3927 and KHDRBS2

DIOPT Version :9

Sequence 1:NP_611681.1 Gene:CG3927 / 37576 FlyBaseID:FBgn0034739 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_016865823.1 Gene:KHDRBS2 / 202559 HGNCID:18114 Length:413 Species:Homo sapiens


Alignment Length:196 Identity:84/196 - (42%)
Similarity:127/196 - (64%) Gaps:8/196 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QKFLADLDAERKRLSAEFPLCALLIDESVDRVY-STGRIPGKE-PFADVYQQKPMKIIQKVFVPV 89
            :|:|.:|.||:..|...|...:.|:.|.:::.. |.|:...:| .:.||...|.:|:.::|.:||
Human     4 EKYLPELMAEKDSLDPSFVHASRLLAEEIEKFQGSDGKKEDEEKKYLDVISNKNIKLSERVLIPV 68

  Fly    90 NKFPKFNFTGKILGPKGNSLRRLQEETHCKIVIKGRNSMRDRNKEEELRSSGDPRYAHLHKDLFL 154
            .::|||||.||:|||:||||:||||||..|:.|.|:.||||:.||||||.||:.:||||..:|.:
Human    69 KQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKAKEEELRKSGEAKYAHLSDELHV 133

  Fly   155 EVSAVAPPAECYARIAYALAEIRKYLIPDDNDDVWHEQQRELMEMNPKSAK------KSNGLNMA 213
            .:...|||.|.|:|:::||.||:|:|:||.||::..||.|||..:|.....      :..|:.:|
Human   134 LIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSEDSGRGRGIRGRGIRIA 198

  Fly   214 P 214
            |
Human   199 P 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3927NP_611681.1 SF1_like-KH 83..201 CDD:239088 64/117 (55%)
KHDRBS2XP_016865823.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155058
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8456
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.