DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3927 and Khdrbs1

DIOPT Version :10

Sequence 1:NP_611681.1 Gene:CG3927 / 37576 FlyBaseID:FBgn0034739 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_035447.3 Gene:Khdrbs1 / 20218 MGIID:893579 Length:443 Species:Mus musculus


Alignment Length:178 Identity:77/178 - (43%)
Similarity:116/178 - (65%) Gaps:1/178 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EVAQKFLADLDAERKRLSAEFPLCALLIDESVDRVY-STGRIPGKEPFADVYQQKPMKIIQKVFV 87
            |...|:|.:|.||:..|...|.....|:...::::. ...:...:|.:.|::..|.||:.::|.:
Mouse    98 EPENKYLPELMAEKDSLDPSFTHAMQLLSVEIEKIQKGESKKDDEENYLDLFSHKNMKLKERVLI 162

  Fly    88 PVNKFPKFNFTGKILGPKGNSLRRLQEETHCKIVIKGRNSMRDRNKEEELRSSGDPRYAHLHKDL 152
            ||.::|||||.||||||:||:::||||||..||.:.|:.||||:.||||||..|||:||||:.||
Mouse   163 PVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDL 227

  Fly   153 FLEVSAVAPPAECYARIAYALAEIRKYLIPDDNDDVWHEQQRELMEMN 200
            .:.:....||.|.||.:|:|:.|::|:|:||..||:..||..||..:|
Mouse   228 HVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLN 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3927NP_611681.1 KH-I_KHDRBS 77..178 CDD:411812 55/100 (55%)
Khdrbs1NP_035447.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..94
Involved in homodimerization. /evidence=ECO:0000250|UniProtKB:Q07666 100..260 69/159 (43%)
Qua1 102..153 CDD:465079 10/50 (20%)
KH-I_KHDRBS1 152..257 CDD:411896 57/104 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..317
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 326..345
Interaction with HNRNPA1. /evidence=ECO:0000250|UniProtKB:Q07666 351..443
Sam68-YY 366..415 CDD:465182
Interaction with ZBTB7A. /evidence=ECO:0000250|UniProtKB:Q07666 400..420
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 411..443
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.