DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3927 and K07H8.9

DIOPT Version :9

Sequence 1:NP_611681.1 Gene:CG3927 / 37576 FlyBaseID:FBgn0034739 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_501390.1 Gene:K07H8.9 / 177620 WormBaseID:WBGene00019509 Length:254 Species:Caenorhabditis elegans


Alignment Length:229 Identity:60/229 - (26%)
Similarity:102/229 - (44%) Gaps:45/229 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PSELTEKQNQDQPTYQPRLNEVAQKFLADLDAERKRL----SAEFPLCALLIDESVDRVY----- 59
            |..:...:..||       .:|...:...|.||:.||    .|.|.:  .||||.:.|::     
 Worm    26 PKSIQIHEESDQ-------MDVVISYFKLLLAEKSRLLQYGQANFSV--HLIDEEIGRLFMAPIS 81

  Fly    60 --STGRIP--GKEP--FADV------------YQQKPMKIIQKVFVPVNKFPKFNFTGKILGPKG 106
              ..|.:.  |:|.  |.|:            ..:..:.:.:.:.:||..:|.:||.|:|:||:|
 Worm    82 MADIGILEECGREALRFTDLGAMFSDSDDSMHSDEDEVTLTESIRIPVETYPTYNFIGRIIGPRG 146

  Fly   107 NSLRRLQEETHCKIVIKGRNSMRDRNK---EEELRSSGDPRYAHLHKDLFLEVSAVAPPAECYAR 168
            .:.::|:::|.|:|:|:|.:|    ||   ....::.||.....:...|.:.|....|..|..||
 Worm   147 TTAKQLEKDTGCRIMIRGNHS----NKMYGNALHKTHGDGSQDAIDLPLRVIVETSGPRREATAR 207

  Fly   169 IAYALAEIRKYLI--PDDNDDVWHEQQRELMEMN 200
            |..||..::..|:  ||..|::...|..||..||
 Worm   208 ITAALETVQVLLVPPPDGRDELKRRQLVELAIMN 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3927NP_611681.1 SF1_like-KH 83..201 CDD:239088 39/123 (32%)
K07H8.9NP_501390.1 SF1_like-KH 122..245 CDD:239088 39/124 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.731683 Normalized mean entropy S1317
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.